KEGG   Paraburkholderia caledonica: CUJ87_15945Help
Entry
CUJ87_15945       CDS       T05740                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CUJ87_15945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pcj03011]
    CUJ87_15945
Ribosome [BR:pcj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CUJ87_15945
  Bacteria
    CUJ87_15945
  Archaea
    CUJ87_15945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXF15717
UniProt: A0A2Z5MGR3
Position
PHRS4_A:complement(3562495..3562824)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaaaacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggctgcgggaatcgtgaaaaaggtcgtgctgtcggcgatcgcgaatgcggagcat
aacgaaggcgccgatatcgatgagctcaagatcacgagcatttacatcgacaaggctgcg
tcgctcaagcgttttaccgcgcgcgctaaaggccgcggtaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system