KEGG   Paraburkholderia caledonica: CUJ87_18225Help
Entry
CUJ87_18225       CDS       T05740                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00564  Glycerophospholipid metabolism
pcj01100  Metabolic pathways
pcj01110  Biosynthesis of secondary metabolites
Module
pcj_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CUJ87_18225
Enzymes [BR:pcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CUJ87_18225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC
Motif
Other DBs
NCBI-ProteinID: AXF16413
UniProt: A0A2Z5MGX7
Position
PHRS4_B:207180..208424
Genome map
AA seq 414 aa AA seqDB search
MTDNDKTGTERRRLGGWLPSNEEHLARYRTDLAEKARARAMHAPRTSAVEDLAALLSGDP
VLRMDMTRAINQAREAGYVLGYSSIDELMVIIDYVMTYAPPFSETSLIHCPLNAVLDWPM
CMPSGYALFRDPALNQRLKRVLNCWCGFLSGPHSREHLNTSAPNGWFSPEADEKIGMSQF
VCDTGKPYWGFSSWNDFFTRRFREGVRPVDQPDNDKIIVSACEAAPYNIQTDVKLTDTFW
IKSQPYSLLDMFSASQREVAQRFVGGSIYQSFLSAFNYHRWHAPVSGVIKEAYALDGTYY
SDADSEGRDAGGLNDSQGYITAVAARAVIVIESDDPAIGQVGCLFVGMADVSSCMIEALP
GQRVAKGDEIGFFQYGGSTCCLVFEPGVISSFVPQPPFDNPPPVKVNAHIATAK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaacgacaaaaccggaaccgagcggcgcaggcttggcggctggctgccatcc
aacgaagagcatctcgcgcgatatcgcaccgacctcgcggaaaaagcccgcgctcgcgcg
atgcatgcgccgcgcacgtcggcggtggaagatctggccgcgcttcttagcggcgacccc
gttcttcggatggacatgacgcgtgcaatcaatcaggcccgtgaagcgggttatgtgctc
ggctattcgtcaatagacgagttgatggtcatcatcgattacgtaatgacttatgcgccg
ccgttcagcgagaccagtctgattcactgcccattgaatgcggtgctggactggccgatg
tgcatgccgtccggctacgcgctgttccgcgacccggcattgaaccagcggcttaaacgc
gtgctcaattgctggtgcgggttcctgagtgggccgcattcgcgtgaacacctgaatacg
tcggcgccgaatggatggttttcgcccgaggccgatgagaaaatcggcatgtcgcagttc
gtctgcgataccggcaagccgtattggggcttttcgtcatggaacgactttttcacgcgc
cggttccgcgagggcgtgcggccagtcgatcagccggataacgacaagatcattgtcagc
gcctgcgaggcggctccgtataacatccagacagacgtcaagctgaccgacaccttctgg
ataaagtcacagccttattcgctactggatatgttttctgcaagccagcgcgaagttgca
cagcgctttgtcggcggctcgatctatcagtcctttctcagtgcattcaattaccaccgg
tggcatgcgccggtaagtggcgtcatcaaggaagcgtacgcgctggacggcacctattat
tccgacgccgattcggaaggccgcgacgccggcggtctgaacgattcgcagggctacatt
accgcggtggcggcgcgcgccgtgatcgttattgaaagcgacgatcccgcgatcggccag
gtcggctgtctcttcgtcggcatggccgatgtgtcgtcgtgcatgatagaggcgttgcct
ggccagcgcgtcgccaagggcgatgaaataggctttttccagtacggcggttcgacctgc
tgtctcgtcttcgaaccgggtgtcatcagcagtttcgtgccgcagccccctttcgacaac
ccgccgccagtcaaggtgaacgcgcacattgcgaccgcgaagtaa

DBGET integrated database retrieval system