KEGG   Paraburkholderia caledonica: CUJ87_29185Help
Entry
CUJ87_29185       CDS       T05740                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00020  Citrate cycle (TCA cycle)
pcj00480  Glutathione metabolism
pcj01100  Metabolic pathways
pcj01110  Biosynthesis of secondary metabolites
pcj01120  Microbial metabolism in diverse environments
pcj01130  Biosynthesis of antibiotics
pcj01200  Carbon metabolism
pcj01210  2-Oxocarboxylic acid metabolism
pcj01230  Biosynthesis of amino acids
Module
pcj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUJ87_29185
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUJ87_29185
Enzymes [BR:pcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CUJ87_29185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: AXF18236
UniProt: A0A2Z5MNM3
Position
PHRS4_B:2598947..2601175
Genome map
AA seq 742 aa AA seqDB search
MSTPPKIIYTLTDEAPALATYSLLPIVKAFTRSSDVIVETRDISLAGRIIAAFPDYLTAE
QKGSDDLAELGGLTTRPEANIIKLPNISASVPQLKAAITELRDQGYKLPPYPDVATTETE
KDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWAADSKSHVAHMSGG
DFYGSEKSALIAAAGAVKIELTAADGTKTVLKEKTPVQAGEIIDASVLSKNALRSFIEAE
IADARSKGVLFSVHLKATMMKVSDPIIFGHVVSVFYKDVLTKHADALAQAGFNPNNGIGD
LYARLKDLPAETAAQIEADIKAQYEQRPQLAMVNSDKGITSLHVPSDVIVDASMPAMIRE
SGKMWGADGALHDAKAVIPDRCYAGVYQAVIEDCKKNGAFDPVTMGTVPNVGLMAQAAEE
YGSHDKTFQIPANGVVRVTDASGAVLIEQTVEAGDIWRMCQTKDAPVQDWVKLAVNRARA
TSTPAVFWLDAARAHDAQIIKKVEQYLKDHDTNGLDIRIMTPVEATKFSVERIRAGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMFETGAGGSAPKHVQQLVEEGFL
RWDSLGEFLALAASLEHLSSAYHNPKAQVLAKTLDQATGKFLDNDKSPARKVGGLDNRGS
HFYLAMYWAEALAAQTEDAALQAQFAGVAKAMADNEAKILEELRAVQGKPVDIGGYYRPN
VELTSKAMRPSATLNEIVDSIA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaccgccgaagatcatctacaccctcaccgacgaagcgcctgctctggcgact
tactcgctgctgccgatcgtcaaggcgttcacgcgctcgtccgacgtgatcgttgaaacg
cgcgatatttcgcttgctggccggatcatcgctgcatttccggactacctgaccgcggaa
cagaagggttccgacgatctggcggagctgggtggactcacaacgcgccccgaagcgaac
atcatcaagctgccgaacatcagcgcttcggtgccgcaactgaaggccgcgatcaccgaa
ttgcgcgatcagggctacaagctgccgccgtatccggacgtcgccacgacggaaacggaa
aaagacgtcaaggcacgctacgacaagatcaagggcagcgcggtcaaccctgtgctgcgc
gaaggcaactcggaccgccgcgcgccgctgtcggtgaagaactacgcacgcaagcatccg
cacaaaatgggcgcatgggctgcagactccaagtcgcatgtcgctcacatgagcggcggc
gatttttacggcagcgaaaaatcggcgctgatcgcagcggccggtgcggtcaagatcgaa
ctgacggctgccgacggcacgaagacggttctgaaggaaaagacgccggtgcaggcgggc
gagattatcgacgcgtcggtgctcagcaagaacgcgctgcgcagcttcatcgaagcggaa
atcgccgacgccaggagcaagggcgtgctgttctcggtgcacctgaaagccacgatgatg
aaagtgtccgatccgatcatcttcggtcacgtcgtgtcggtgttctacaaagacgtgttg
accaagcacgctgacgcgctggcgcaagcgggcttcaatccgaacaacggtatcggcgat
ctgtacgcgcgcctcaaagacctgccggccgaaacggctgcgcagatcgaagccgacatc
aaggctcagtacgaacagcgtccgcaactggccatggtcaactcggacaagggcattacg
agcctgcacgtgccgagcgacgtgatcgtcgacgcgtcgatgccggccatgattcgcgag
tcgggcaagatgtggggcgcggacggcgcactgcacgacgccaaggccgtgattccggac
cgttgctacgcgggcgtgtatcaggcagtgatcgaagactgcaagaagaatggcgcattc
gatccagtcaccatgggcacggtgccgaacgtcggcctgatggcacaagccgctgaagaa
tacggttcacacgacaagacgttccagattccggcgaacggcgtggttcgtgtgaccgac
gcaagcggcgctgtgctgatcgagcaaacggtggaagcgggcgacatctggcgcatgtgc
cagaccaaagacgcaccggtgcaggactgggtcaaactcgcggtgaaccgcgcgcgtgcc
accagcacgccggccgtgttctggctggacgcggctcgtgcacacgacgcgcagatcatc
aagaaggtcgagcagtatctgaaggaccatgacacgaacggtctggacattcgcatcatg
acgccggtcgaggcaacgaagttctcggtcgagcgcatccgcgccggcaaggacacgatc
tcggtcaccggcaatgtgctgcgtgactacctgaccgacctgttcccgatcatggaactg
ggtaccagcgcgaagatgctgtccatcgtcccgctcatggcaggcggcggcatgttcgaa
acgggcgcgggcggttcggcgccgaagcacgttcagcaactggtcgaagaaggtttcctg
cgttgggattcgctgggtgaattcctggcgctggcagcgtcgctcgaacatctgagcagc
gcgtatcacaacccgaaggcgcaagttctggccaagacgctggatcaggcaaccggcaag
ttcctcgacaacgacaagtcgccggcgcgcaaggtcggcggtctcgacaaccgtggcagc
cacttctacctcgcgatgtactgggccgaagcactcgccgcgcaaacggaagacgccgcg
ttgcaggcacagttcgccggcgtagccaaggcgatggccgacaacgaagcgaagatcctc
gaggaactgcgtgccgtgcaaggcaagccggtggatatcggcggctactatcgtccgaac
gtcgaactgacgagcaaggctatgcgcccgagcgccacgctgaacgaaatcgtggactcg
atcgcgtga

DBGET integrated database retrieval system