KEGG   Candidatus Pantoea carbekii US: BMSBPS_0381Help
Entry
BMSBPS_0381       CDS       T03853                                 

Definition
(GenBank) succinyl-CoA synthetase alpha chain SucD
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pck  Candidatus Pantoea carbekii US
Pathway
pck00020  Citrate cycle (TCA cycle)
pck00640  Propanoate metabolism
pck00660  C5-Branched dibasic acid metabolism
pck01100  Metabolic pathways
pck01110  Biosynthesis of secondary metabolites
pck01120  Microbial metabolism in diverse environments
pck01130  Biosynthesis of antibiotics
pck01200  Carbon metabolism
Module
pck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pck_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMSBPS_0381
   00640 Propanoate metabolism
    BMSBPS_0381
   00660 C5-Branched dibasic acid metabolism
    BMSBPS_0381
Enzymes [BR:pck01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMSBPS_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AKC32188
UniProt: U3U8L9
Position
complement(539046..539936)
Genome map
AA seq 296 aa AA seqDB search
MSILIDKNTKVICQGFSGNQGTFHSKQALAYGTKLVGGVTPGKGGTSHLGLPIFNTVREA
IEVTGATATVIYVPAPFCKDSILEAIDARMKLIITITEGIPILDMLITKIKLDETGVRMI
GPNCPGVITPGQCKIGIMPGHIHQVGSIGIVSRSGTLTYEAVKQITDMGYGQSTCVGIGG
DPILGSNFIDILKMFQNDTQTKVIVMIGEIGGSSEQEAAEFIKKHITKPVVSYIAGVTAP
KGKRMGHAGAIISGIQGTAEEKFSALEEAGVKTVHNLCDIGTAVKEIMLFHESSKF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttaattgataaaaataccaaagtaatttgccaaggttttagtggtaaccaa
ggcacttttcattctaaacaagcgttagcttacggtacaaagttagttggtggtgtaacg
cctggtaaaggtggtactagtcacctaggtctacctatatttaatactgttcgcgaagct
atagaagtgactggcgcaaccgctacagtgatatatgttcctgcacccttctgcaaagat
agcattctagaagcaattgatgcaagaatgaagttaattattactattacagaaggtata
ccaatacttgatatgctaattacgaagataaaattagatgaaacaggtgtaagaatgatt
ggtccaaattgtcctggtgtaataacaccaggacaatgtaaaattggtattatgccaggc
catattcatcaagttggtagtattggtattgtatcgcgttcaggtactttaacctatgaa
gcagttaaacaaatcacagatatgggttatggtcagtcaacatgtgtaggtattggaggt
gacccaattttaggttctaattttattgatattttaaagatgtttcaaaatgacacacaa
actaaagtaattgtaatgattggtgaaattggtggtagttcagaacaggaagcagctgaa
tttatcaaaaaacacatcactaaacctgttgttagctatattgctggtgtaactgcaccg
aaaggaaaacgtatgggtcatgcaggtgctattatttcagggatacaaggcactgccgag
gaaaaattttctgctcttgaagaagctggtgtaaaaactgttcataatttatgtgatatt
ggaacagcagtcaaagaaataatgttattccatgaatcatctaaattttaa

DBGET integrated database retrieval system