KEGG   Pyrobaculum calidifontis: Pcal_0081Help
Entry
Pcal_0081         CDS       T00483                                 

Definition
(GenBank) hypothetical protein
Organism
pcl  Pyrobaculum calidifontis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABO07521
UniProt: A3MSA4
Position
77005..80445
Genome map
AA seq 1146 aa AA seqDB search
MRGQLILLSAFIAAVAVAAIMTAQIALQMGSYSAGARTGYGIYAKAWPEVVDLADSHVLQ
ATAKASAQLSTAATTTGLYAWLSDLPYYAAKWYTNSSLSLLKTALLPIGAQLDFKYRIFY
TGFNGTLGPYPQAVEYSRWNLDPVRSGFLTIPGATLYRLVVTWQSDDYGGYYVVTYGAHV
SEPGAAGEVYNVALADLLRKLGELEEEKIKSSLFAFLVDSQTCKLYQLPWWAEIKNCPLC
LLHVRLPSSSSDEVSGFKLEKGKAVEVLLVFIPNLQGDEIPVLKSGPCASGQPMLSDIVK
VNKAVNNEPKAAFAPQVGYEQYPWGGRPAGYSVSYYWGADEIASWGKSVVNTQGCYHSPT
GGVIRNEYGVTVEDVPDFRPVARVYARYAVGTTNWAFNVYYKLNTPQEDDDDNLRNLGWR
GFTVEALVKPLKGIIRPARLDLYYAWNTNPPPPSRHPICAYLLAVQAVVPAIVWTNWYAG
NGVWNGRTWDDAGSLTYGTSWYLFSISADTSRVVYSVYSYNTTRPLIRLATKTTTHSFGG
DWRFYIVLGSAIVDNPASGTPEEAYYAYVRVRPWVDPPPSVSLAPVDKTPLARPGRVDVV
ALSATKVEANINASGSVGLANVERLNISRTIGLSVKVVEWSVDGSNPNQDRYHYRVRVES
TIPRGAVAAQFTLFYSLGSTYVNTTCVDNGLCTATLAEYLGYSGGRDVAEWEVEFTVPKR
ASHAIFVNVFGSKVAVSTAQPKLYALGGGTTWYLINEGDGTGVLYIPWKKSGQQVCTRWL
ADYSPKDPRFIGVYDVKYKCPNCGPCESWTVVLVPPGSLVRLDFTDSVSLSVLNTFRAQW
QPPILPTPPLPSCPNPIYVRFYIPGNASKGYYVIYVPPSDTQGPLLTYGGVDRRSAYAYL
GGSWKGVNLYRDGPSGVGGYWVRLEGDLTNKAVLAVFCQGGTFTPPQDLFRPPQQPSSYF
WTLTGPVEVTLQQASLNEFKDGFTVVFGHYRSVPSWVALYNGTWSDSMLSCASNRRMVGI
QQIGSPKWWWDYDGFCYDRHIWELYGAVSGERNFTISVARSVVLYQIFTSGAWGSGQNPW
LRSYPNVVPSDGPSDLRNRAMTAFQRARAGVAGGQRYSVAVIPFTWPRPFFYVDSGTAVR
GPFETT
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccagctgatactcctatcagccttcatcgccgccgtggccgtggcggcgata
atgacggcgcaaatcgccctacagatgggctcctactccgcgggggcgaggactgggtac
ggcatatacgcaaaggcgtggcccgaggtggtggatctcgccgactcccacgtactccaa
gccacggcaaaggcctccgcccagctctcaaccgcagcaaccaccacagggctctacgcg
tggctaagcgaccttccatactacgcagcgaagtggtacaccaacagctcgctctcgctc
ctaaaaaccgcgctgttgcccataggggcccagctggacttcaaataccgaatattctac
acaggcttcaacggcaccctgggcccctacccacaggcagtggaatactcgcggtggaac
ctagaccccgttaggagcggctttctcacaatacccggcgcaacgctctacaggcttgtg
gtcacctggcaaagcgacgactacggcggctactacgtcgtcacatacggagcccacgtc
tctgagccaggcgccgctggcgaggtatacaacgtagccctagcagacctcttgagaaag
ctaggcgaattggaagaagagaaaatcaagtccagcctcttcgccttcctagtagacagc
cagacgtgcaaactctaccagctaccctggtgggccgagataaagaactgccccctctgc
ctactacacgtcagactgccctcctcttcctccgacgaggtgtccggctttaagctggag
aagggcaaggcggtggaggtgctcctcgtcttcattccaaatctgcaaggcgacgagata
ccggtgctgaagtctggcccatgtgcgagcggccagcctatgctgtcagacatcgtgaag
gtgaacaaggccgtgaacaatgagccaaaggctgcgttcgcaccgcaagtaggatacgag
cagtatccgtggggcggccgtccagcggggtacagcgtttcatactactggggcgccgac
gagatagcctcatggggcaaaagcgtagttaatacgcaaggctgttatcattcgccaacg
ggcggagtaattagaaatgagtatggtgttacggtggaagacgtcccagacttccgcccc
gttgcacgagtctacgccaggtacgccgttggcaccacgaattgggcctttaatgtatat
tacaaattgaacactccacaagaagatgatgatgataatctgagaaatcttggctggcgt
ggcttcacagtggaggcgctggtcaagccgcttaaaggcataataaggcccgccaggctt
gacctctactatgcctggaacaccaacccacccccacccagcagacaccccatatgcgcc
taccttctggcagtgcaggccgttgtgccagccatcgtgtggacaaactggtacgcgggg
aacggcgtgtggaacgggaggacttgggatgatgcgggttcgctaacttatggcacatcc
tggtacctcttctccatatcggcggacacctccagagtggtatacagcgtatacagctac
aacacgacaaggcccctcatacggctggccactaagacgaccacccactcgtttggcggc
gactggaggttctacatagtgctgggaagcgccatagtggacaatcccgcctccggtacg
cctgaggaggcgtactacgcctatgtgagagttaggccctgggtagacccgcccccctcc
gtgtccctcgcgcccgtggacaagacccccctcgccaggccgggcagagtagacgtggta
gcactgagcgcaaccaaggtggaggcaaacataaacgccagcggcagtgtgggtcttgcc
aacgtagagcggctcaacatttcgcgcacaataggcctaagcgtcaaggtggttgagtgg
agcgtcgatgggagcaaccccaaccaggacagataccactacagagttcgggtggagtcc
actatcccccgcggcgccgtggcggcccagttcaccctcttctacagcctgggctccacc
tacgtcaacaccacgtgcgtcgacaacggcttgtgcacagccacactggctgagtacctc
ggctactccggcggcagggatgtcgccgagtgggaggtggagttcaccgtgcccaagagg
gcgagccacgccatatttgtcaatgtcttcgggtctaaggtggctgtctccacggcccag
cccaagctctacgcgctgggaggcggcacgacgtggtacctcataaacgagggagacggc
accggcgtcttgtacataccgtggaagaagtctggccagcaggtttgcacgcgctggctg
gccgactacagccccaaggacccgaggttcataggcgtttacgacgttaagtacaagtgt
cccaactgcggcccgtgcgagagctggacagtcgtcctcgtaccgcctggctcgctcgtg
aggctagacttcacagactcggtgtcactcagcgtcttgaacacgtttagagcacagtgg
caaccgccgattttgccgacaccgccgctaccaagctgtcctaaccctatatacgtcaga
ttctacatacccggcaacgccagtaagggttactatgttatttacgtaccgccaagcgat
acgcagggcccgcttctcacgtacggcggcgtagataggcgtagtgcttatgcatattta
ggcggtagctggaagggggtgaatctctacagagatgggccaagcggcgttggcggatat
tgggtcagacttgagggggatttgactaacaaagccgtcttagcggtcttctgccaagga
gggacatttacgcctcctcaagacctctttaggcctccccaacaaccctccagctacttc
tggacgctcactggccctgtggaagtcaccttacaacaagcatcgctgaatgagttcaaa
gacgggttcaccgtggtgtttggccactacaggagtgtgccgagttgggtggctctgtac
aacggaacttggtcggactcaatgctatcgtgtgcgtctaacaggagaatggtgggcata
cagcaaattggcagtccaaagtggtggtgggactacgacggcttctgctacgacaggcac
atatgggagctctacggcgccgtgagtggcgagcgcaacttcacaatatcggtggccagg
tccgtcgtgttgtaccagatcttcacgagcggcgcgtgggggtcggggcagaacccgtgg
cttaggtcttaccccaacgtcgtgccgtccgacgggccgtcagacctcagaaacagggcc
atgacggcgtttcagagggcgcgcgccggggtcgccggcgggcagagatacagcgttgcg
gttatacccttcacgtggcctcggccgttcttctacgtggactctggcacagcggttagg
ggcccgtttgagacgacatga

DBGET integrated database retrieval system