KEGG   Pyrobaculum calidifontis: Pcal_0083Help
Entry
Pcal_0083         CDS       T00483                                 

Definition
(GenBank) hypothetical protein
Organism
pcl  Pyrobaculum calidifontis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arch_flagellin
Motif
Other DBs
NCBI-ProteinID: ABO07523
UniProt: A3MSA6
Position
81125..81688
Genome map
AA seq 187 aa AA seqDB search
MRGSISTSALILFVAFAATVAVLAYIVDMRAQWVLERDVESLAQSAADFAASQIRDSLAA
ASIPGVVELNRSLLVPRDFYGFDTAGVSICVGNRGGFLYVNVTASGTRGRGSATAKATAW
LYNVTKWAIDHGRVVYLVGQYGPCGSPPSTCFATVIVGARKVAVVNLTRPGCSAMLVKSG
VWIIPRG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagggggtctatctccacgtcggccttgatcctctttgtggcatttgcggcgactgtg
gccgtgttggcctacattgtggacatgagggcgcagtgggtgttggagcgggacgtggag
tcgctggcccagtcggcggcggacttcgccgcgtctcagattagggactcgcttgccgcg
gcgagtatacccggcgtagtggagctgaaccgctctctgttggtgccgcgggacttctac
ggctttgacactgcgggcgtctccatatgcgtggggaacagaggcggcttcctctatgta
aacgtcacggcgtcggggacgagggggcggggctcggcgacggcgaaggccacggcatgg
ctgtacaatgtgacaaagtgggccatagaccacggccgggtggtgtacctcgtgggccag
tacggcccctgcggcagtcccccctccacctgcttcgccacagtgatcgttggcgcgagg
aaggttgctgtggtcaacttgacgcggcctggctgctcggcaatgcttgtgaagtccggc
gtgtggataattccgcgcggctag

DBGET integrated database retrieval system