KEGG   Pyrobaculum calidifontis: Pcal_0221Help
Entry
Pcal_0221         CDS       T00483                                 

Definition
(GenBank) GTP cyclohydrolase I
Organism
pcl  Pyrobaculum calidifontis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueF GTP_cyclohydroI IF3_C
Motif
Other DBs
NCBI-ProteinID: ABO07658
UniProt: A3MSP1
Structure
PDB: 

Position
complement(222414..222743)
Genome map
AA seq 109 aa AA seqDB search
MLKVSKSPSLVRLKTRGESVCPISKTVDSFEVSVEYIPRGAVLAIEEFKKMVDSYRGREI
LHEELAVDLLEKVKAAVNPPYVKVTVKSYYIGVEVEVVAESGGVPPVYI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaggtctccaagtctccgagcctcgtgcgcctcaagactaggggcgagtctgtg
tgcccaatcagcaagacagtggactcgtttgaggtctctgtggagtacataccccgcggc
gccgtcctcgccatcgaggagttcaaaaagatggtggactcctacaggggaagagagatc
ctccacgaggaactggccgtggacctcttggaaaaggtaaaggccgcggtaaatccccca
tatgtgaaagtaactgtcaagtcgtactacataggcgtggaagtcgaggttgttgcagag
tccggcggcgtcccgccggtctacatctaa

DBGET integrated database retrieval system