KEGG   Pyrobaculum calidifontis: Pcal_1213Help
Entry
Pcal_1213         CDS       T00483                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01130  Biosynthesis of antibiotics
pcl01230  Biosynthesis of amino acids
Module
pcl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcal_1213
Enzymes [BR:pcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pcal_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG FMN_dh NanE Dus Ferritin
Motif
Other DBs
NCBI-ProteinID: ABO08638
UniProt: A3MVH1
Position
1124137..1124889
Genome map
AA seq 250 aa AA seqDB search
MDFLAAVKRAVELRLATEPPPPPRTAPLVDFAKGLGEFGIIAEYKRASPRGVVRLDLPPW
AYFAEVYPHVSAFSVLTEPFWFLGDYRFLPLAKAFKPVLMKDFIIDKRQIDAAYGYGADA
VLIIYKLVGREKAMELAEYAQRLGLTPVVEVDNVQDAKEVATWGGRVVLGINARDLRTLE
VSLSRAFEVAKALRGDVDYIIESGISKPEEVERACEVYARGVLVGTALMKNPQLAKELAH
AAHRACKARS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacttcctggccgcggtcaagcgggctgttgagctcaggctggccacggagcccccg
ccgcctccccgcacggcgccgctggtggacttcgccaaggggctcggggagtttgggata
attgccgagtacaagcgcgcctcgccgcggggcgtagtaaggctggacctacccccctgg
gcctacttcgccgaggtatacccccacgtctccgctttctcagtactgacagagcccttc
tggttcctaggcgactaccgcttcctgcccctggccaaggcctttaagcccgtcttaatg
aaggactttataatagacaagaggcagatagacgccgcctacggctacggcgcagacgcc
gtgctcataatatacaagctcgtggggagggagaaggcgatggagttggccgagtacgcc
cagcgcctaggcctaaccccagtggtggaggtggacaacgtccaagacgccaaggaggtg
gccacctggggcgggagagtggtgttggggataaacgcgagagacctgcgaactctcgag
gtgagcctctccagggcctttgaggtggccaaggcgctgaggggggacgtggattacata
attgaaagcggcatctccaagccggaggaggtggagagggcctgcgaggtctacgcaaga
ggcgtgttggttgggacggccctgatgaaaaacccgcagttggccaaggagcttgcccac
gccgcacatcgggcttgtaaggctcgttcataa

DBGET integrated database retrieval system