KEGG   Pyrobaculum calidifontis: Pcal_1398
Entry
Pcal_1398         CDS       T00483                                 
Name
(GenBank) tungstate/molybdate transport system permease protein
  KO
K15496  molybdate/tungstate transport system permease protein
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pcl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pcal_1398
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcl02000]
    Pcal_1398
Transporters [BR:pcl02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter
    Pcal_1398
SSDB
Other DBs
NCBI-ProteinID: ABO08818
UniProt: A3MW01
Position
complement(1311674..1312402)
AA seq 242 aa
MMDAVKAVAASTAALLALLLLALPLFFLSAPPPGFVESFLFTAAASAAAAGGSLLPGLAV
AMAARRGGAWGALGMVLYVPALVPPTSVGVLLLAAFSTPRLLCGDCPLSQFVSAWVVNQP
LGVFLAMWVMALPVAFSIYDGALREERAEAFFRSLGFSGLRLLVLTAMSLREATLSAALF
AWLRGFGELGVLLIFANYPYAASIYIYNAWLIYGVGPAIGASLAVVVTALAVGYAARRWL
SR
NT seq 729 nt   +upstreamnt  +downstreamnt
atgatggacgccgtgaaggctgtcgccgcctccaccgccgccctcctggcgctcctcctc
ttagccctccccctgttctttctctctgcgcctccgccggggtttgtggagagcttcctc
ttcacggccgcggcctcggcggctgcggcgggcggctctcttctgccgggccttgcggtg
gctatggcggctaggaggggcggtgcttggggggccttgggcatggtcctctacgtcccg
gcgcttgtcccgccgacgtctgtgggagtgctcctcctcgccgccttctccacgccccgc
ctcctctgcggcgactgccccctctcgcagttcgtctccgcgtgggtggtgaaccagccg
ctcggcgtcttcttggccatgtgggtcatggcgctccccgtggccttctccatatacgac
ggcgccttgagggaggagagggctgaggcctttttccggtcgctgggcttctccggcctt
aggctcctggtgctcacggccatgtcgctgagggaggccaccctctcggcggctctcttc
gcatggctgaggggcttcggcgagctgggggtgctcctaatattcgccaactacccatac
gccgcctctatctacatctacaacgcctggctcatctacggcgtcggcccggccataggg
gcctccctggccgttgtagtaacagcgctggcggtgggctacgcggcgaggcgatggctc
tcgaggtag

DBGET integrated database retrieval system