KEGG   Pyrobaculum calidifontis: Pcal_1399
Entry
Pcal_1399         CDS       T00483                                 
Name
(GenBank) conserved hypothetical protein
  KO
K15495  molybdate/tungstate transport system substrate-binding protein
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pcl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pcal_1399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcl02000]
    Pcal_1399
Transporters [BR:pcl02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter
    Pcal_1399
SSDB
Motif
Pfam: SBP_bac_11
Other DBs
NCBI-ProteinID: ABO08819
UniProt: A3MW02
Position
complement(1312399..1313346)
AA seq 315 aa
MSPLAPPPSSATTPAPTSAAVSQTQSSAQAAACGGSVIGYVAPTLVRVVKDAAREAGLSV
EGIQSVGSLEGLRRIQQGSVPDVYASVDIELAADVKDARQIYSLGRFKLALACARPIASV
SDLRGAKTALADPNKAPIGYRELAVAYMLKKGGVADLTARYEALGIRFVDTAVGFNVTVP
TALFSTAEVKVAPSLDGSWSMFETGQVDCVFAYLPFILGKGVELKPAGASAELWEVYVGD
YGRGQFYVYVFKPPYDFFQDPPLAIYVNFVDPSGRVVRAVRVGRFEAFVASFTERGDCVV
EALKKMDLAKYGFVK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtcccccttggctcccccgccgagttctgccacaacgccagcccccacttccgcggcg
gtcagtcagacgcaatcctctgcgcaagccgccgcctgtggcggctcggtgattggctat
gtggcgccgacgcttgtgagagtagtgaaagacgcggctagggaggccggtctctccgtg
gaggggatacagtcggtgggctccttggagggactcaggaggattcagcagggcagtgtc
ccggatgtctacgcctccgtggacatagagctcgccgccgatgtgaaagacgccaggcag
atctactccctggggcggttcaagctggccttggcctgtgccaggcccatagcatctgtg
agcgacctgcggggggcaaagacggccttggcagaccccaacaaggcgcccattggatat
agggaactggccgttgcatacatgctcaagaaggggggcgtggcggacctcacggcgagg
tatgaggctttgggcataaggtttgtagacactgcggtgggcttcaacgtcactgtgcca
acggccttgttctctacggcggaggtcaaggtggctcccagcctcgacgggagctggagc
atgtttgagactgggcaagtggactgcgtcttcgcctacctgcccttcatccttggcaaa
ggcgtggagcttaagcccgcgggggcgtccgccgagctttgggaagtctacgtaggcgac
tacggccggggccagttctacgtctacgtcttcaagcctccctatgactttttccaagac
ccgccgctcgccatatatgtaaacttcgtggacccctctggtagagtggtcagggccgtg
cgcgtgggccgcttcgaggcctttgtggcgtcttttaccgagaggggtgactgcgtggtg
gaggcgttgaagaagatggacttggccaagtacggctttgtcaaatga

DBGET integrated database retrieval system