KEGG   Pyrobaculum calidifontis: Pcal_1770Help
Entry
Pcal_1770         CDS       T00483                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00010  Glycolysis / Gluconeogenesis
pcl00020  Citrate cycle (TCA cycle)
pcl00620  Pyruvate metabolism
pcl00633  Nitrotoluene degradation
pcl00640  Propanoate metabolism
pcl00650  Butanoate metabolism
pcl00680  Methane metabolism
pcl00720  Carbon fixation pathways in prokaryotes
pcl01100  Metabolic pathways
pcl01120  Microbial metabolism in diverse environments
pcl01130  Biosynthesis of antibiotics
pcl01200  Carbon metabolism
Module
pcl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pcl_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1770
   00020 Citrate cycle (TCA cycle)
    Pcal_1770
   00620 Pyruvate metabolism
    Pcal_1770
   00640 Propanoate metabolism
    Pcal_1770
   00650 Butanoate metabolism
    Pcal_1770
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_1770
   00680 Methane metabolism
    Pcal_1770
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_1770
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N E1_dh Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABO09187
UniProt: A3MX20
Position
1641978..1642871
Genome map
AA seq 297 aa AA seqDB search
MSFRLDLLPKKKYVVPGNAACAGCGMMIGLKILGMALGEESVLVIPASCASVVQGLAPKS
GVAMPILNVPFASSPAVATGISEAFKMLGVKGHAVVWAGDGGTADIGFAALSGAAERNSN
IIYIMYDNEAYMNTGIQRSSSTPRTAWTTTTPAGKRERKKDVALLMAMHGVPYVATANIA
YPQDFYRKLKRAAEIQGFKFIHLYTPCPPGWRFDPAKTVEVARLAVETGAWILWEYDNGV
FKLNPPSTVYADKSKRRPLKDYLKLQGRFAHLTEEEIKALEEEVDAKWNTILKLAKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagctttagactagaccttctgccaaagaaaaagtacgtagttcctggcaacgccgct
tgtgcaggctgtggaatgatgatagggctcaagatattgggcatggcgctgggggaggag
tctgtcctagttataccggcctcgtgcgcctctgttgtacaaggccttgcgcctaagtcg
ggcgtggcaatgccgattttaaatgtcccatttgcctcctctccagccgtcgcgacgggg
atctcagaggcgtttaaaatgctcggcgtgaagggccacgccgtggtgtgggccggcgac
ggcgggactgctgatatcggctttgccgcactaagcggcgccgctgagaggaatagtaat
atcatctacataatgtacgacaacgaggcgtacatgaatactgggatacaacggagtagc
tctaccccccgcacagcgtggactactacaacgcctgctggaaaacgtgaacgcaagaaa
gatgtggcgcttctcatggccatgcacggggtgccctatgttgcaacagccaatatagcg
tacccccaggacttctatagaaagcttaagagagccgcggaaatccagggcttcaaattt
atacatttgtacacgccgtgtcctccgggttggcgttttgaccccgctaagacggtggag
gtggctagactcgccgtggagactggcgcgtggattttgtgggagtacgacaacggcgta
tttaagctgaatccccccagcacagtatacgcagataagtcaaagaggaggccccttaaa
gactacttgaagctacaggggcgcttcgcccatttgacagaggaggagataaaggcctta
gaggaggaggtagacgccaagtggaacacgatattaaagctcgctaagctgtag

DBGET integrated database retrieval system