KEGG   Pedobacter cryoconitis: AY601_0355Help
Entry
AY601_0355        CDS       T04341                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00130  Ubiquinone and other terpenoid-quinone biosynthesis
pcm00627  Aminobenzoate degradation
pcm01100  Metabolic pathways
pcm01110  Biosynthesis of secondary metabolites
pcm01120  Microbial metabolism in diverse environments
pcm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AY601_0355
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AY601_0355
Enzymes [BR:pcm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     AY601_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AMP97318
UniProt: A0A127V8L1
Position
397935..398504
Genome map
AA seq 189 aa AA seqDB search
MKKKKIIVAITGASGSVYAKLLLNNLLQLADQIEAVGVVMSDNAKEVWRFELGNSDYEQY
PFTFYSKMDFNAPFASGSAKFDTMIIIPCSMGTLGRIAHGISNDLISRAADVILKERRKL
IAVVRDTPFSLIHINNMKTVTEAGGIICPASPSYYSIPTTIEEAAQTVVSRVIDLAGLEQ
DSYRWNENQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaagaaaatcatcgtcgcgatcaccggagccagcggttctgtctatgctaaa
ctcttattgaataatttgctgcagttggctgaccagatcgaagcggtaggtgtagtgatg
tctgacaacgcaaaagaggtttggcgttttgaattgggaaatagtgattacgaacagtat
ccttttaccttttattcaaaaatggattttaatgctccttttgcttccggatctgcaaaa
tttgatacgatgattattattccttgttctatggggactttaggaagaattgcccatggc
atctctaatgatttaatttcaagagctgctgatgttatcttaaaagaacgcaggaaacta
attgctgtagtaagagatacgccttttagtctgattcatatcaataatatgaaaacggtg
actgaagcaggtggtattatctgtccggccagtccatcttattatagtattccaaccact
attgaggaagcagcacaaactgtcgtgagcagagtcatagaccttgcagggttggagcag
gatagttacaggtggaacgaaaaccagtaa

DBGET integrated database retrieval system