KEGG   Pedobacter cryoconitis: AY601_0375Help
Entry
AY601_0375        CDS       T04341                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00072  Synthesis and degradation of ketone bodies
pcm00280  Valine, leucine and isoleucine degradation
pcm00650  Butanoate metabolism
pcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AY601_0375
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AY601_0375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AY601_0375
Enzymes [BR:pcm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AY601_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: AMP97338
UniProt: A0A127V8M4
Position
417053..417712
Genome map
AA seq 219 aa AA seqDB search
MLDKNGIARRIAKELKDGYYVNLGIGIPTLVANYIPDGINVVLQSENGLLGMGPFPFEGE
EDADMINAGKQTITTLPGSSIFDSAMSFGMIRSQKIDLTILGAMEVSENGDIANWKIPGK
MVKGMGGAMDLVASAKNIIVAMQHINKAGESKLLPKCTLPLTGINCIRKVVTELAVLDIL
PEGGFRLIERAPGVSVDFIKQSTSGKLFAEADVKEMELN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttagataagaacggaattgcgagacgtatcgccaaagaattaaaagacggttactat
gtgaatttaggaattggtatccctacactggtagcaaattatatccctgatggaatcaat
gttgtactgcaatccgaaaatggtttgctgggtatgggcccttttccttttgaaggtgag
gaagatgctgatatgatcaatgcaggaaaacaaacaattactaccttacctggttcttca
attttcgattcagcgatgagcttcggtatgatcagaagtcagaaaattgacctgaccata
ttaggtgcaatggaagtttctgaaaacggagatattgccaactggaaaattcctggaaaa
atggtgaagggaatgggtggggcaatggacttagtggcttctgcaaaaaatatcattgta
gctatgcagcatatcaataaagcaggggaaagtaaattattgccaaaatgcactttgcca
ttaactggtataaattgtatcaggaaagtagttacagaattagcggtacttgatatttta
ccggaaggtggcttcaggttaattgaaagagcaccaggtgtgagtgttgattttattaaa
caatctacctcaggaaagttattcgctgaggcagatgtgaaagaaatggagctaaactga

DBGET integrated database retrieval system