KEGG   Pedobacter cryoconitis: AY601_1522Help
Entry
AY601_1522        CDS       T04341                                 

Definition
(GenBank) Pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pcm  Pedobacter cryoconitis
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcm03016]
    AY601_1522
Enzymes [BR:pcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AY601_1522
Transfer RNA biogenesis [BR:pcm03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AY601_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 LPD1 UMPH-1
Motif
Other DBs
NCBI-ProteinID: AMP98438
UniProt: A0A127VBR6
Position
complement(1756553..1757230)
Genome map
AA seq 225 aa AA seqDB search
MLEIVYQDDHIIAINKPHGLLVHRSSIATDAKEFALQLLRDQVNRRVSPVHRLDRKTGGL
LLFAFEKDVEIALHQQFQNGEIQKKYLAIVRGYAPDSQDIDYPLVKENGAIQEAFTSFIT
LKRAELDIALGQHPTSRYSLVEATPTTGRMHQLRKHFAHIFYPIIGDRKHGCNKQNRFFK
EQWEMTTMLLHASELSFKHPVTKEDIHLKATVQEEFKRVMDIMSW
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaatcgtataccaggatgatcatatcattgcgatcaataaaccacacggacta
cttgtacatcgttcctccattgcaaccgatgcgaaagaatttgccttgcagctcttaaga
gatcaagtgaacagacgcgtaagtcctgtacatcgtttagacagaaaaacaggtggttta
ttactatttgctttcgagaaagatgttgaaattgcattgcatcagcagtttcaaaatgga
gaaatacaaaagaaataccttgcaattgttagaggctatgctcctgacagccaggatata
gattacccattagtaaaagaaaatggtgcaattcaagaagcttttacttcgtttattacc
ttaaaaagagcagaactcgatattgctttgggtcagcaccctacttcaagatactcttta
gtagaagcaacccctacaaccggacgtatgcaccagctccgtaaacactttgcacatatc
ttttacccaattataggtgaccggaaacatgggtgtaacaaacaaaacagattctttaaa
gaacagtgggaaatgacgacaatgctattacatgcctcagaacttagcttcaaacaccca
gtcaccaaagaagatatccatttgaaagccactgtacaagaagaatttaaaagagtgatg
gatatcatgagctggtaa

DBGET integrated database retrieval system