KEGG   Pedobacter cryoconitis: AY601_3489Help
Entry
AY601_3489        CDS       T04341                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AY601_3489
Enzymes [BR:pcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AY601_3489
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AY601_3489
    1.1.1.-  
     AY601_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N NAD_binding_7 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AMQ00355
UniProt: A0A127VG92
Position
complement(4154068..4155135)
Genome map
AA seq 355 aa AA seqDB search
MSVPVMKAARWYAAKDIRVEDAPIPSTDSKQVKIEVQYAGICGSDLHEYAHGPMLIPADV
PYPLNGHIGVTTLGHEFSGVVTEVGEEVKQVKIGDRVVVEPLFRNPESPFIVTGEYNLSE
PLGFIGLTSNGGFAKFVVVEDYMVHPIPDHMSFEQGALVEPAAVAVYAVKSSGLKLGQSC
VIFGAGPIGLLCVQAAIAAGAATVIVVDVAEKRLEKALEIGATQVINGKEKDVSAQVKQL
TAGGADIYIDAAGVQATYDAGIASLKNGGTALLVALFGKPVTTNAFDLVVREITIKGTIA
YRNIFPEVIQLIHTGRMPVEKLVTARIELENIVEEGFEALLNNPTQVKILVKIAK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttcctgttatgaaagctgcccgttggtatgctgctaaagatattagagtagaa
gatgcccctataccctcaacggatagtaaacaagtgaaaatagaagtgcagtacgcaggt
atttgtggttctgatttgcatgagtatgcgcacgggccgatgttgattcctgcagatgtg
ccctatcctttaaacggacatatcggcgtaaccactttaggccatgaattttctggcgtg
gtaaccgaggttggagaagaagttaagcaagtgaaaataggggaccgtgtagtagtagag
cctctttttagaaatcctgaaagtccctttattgtgactggtgagtataatctgtcagaa
cctctgggttttatcggactaacttcgaacggtggttttgcgaagtttgttgtcgtagaa
gattatatggtacatcctattccggaccacatgagttttgagcaaggcgcattagttgaa
ccagctgcggtagctgtatatgcggtaaaaagcagtggattaaagctcggacagtcctgt
gttatatttggagccgggccgattgggttactctgtgtacaggctgcaattgcagcaggt
gctgcaaccgtgattgttgtagatgttgccgaaaaacgtttagagaaagcgcttgaaatt
ggtgctacccaggtcatcaacggaaaagaaaaggatgtatcagctcaggttaagcaatta
actgctggcggtgcggatatttatattgatgcggcaggtgtgcaggcaacttatgatgct
ggaattgctagtttgaaaaatggaggtactgctttattagtcgctctttttggaaaaccg
gtcaccacgaatgcttttgatctggttgtgcgtgaaattaccattaagggtactatagct
taccggaacatctttcctgaagtgattcagctgattcatactggcagaatgcctgttgaa
aaactagtaactgcaagaattgagcttgaaaatatcgtagaagaagggtttgaagcattg
ctgaacaatcctacacaggtgaaaatattggttaaaattgctaaataa

DBGET integrated database retrieval system