KEGG   Pedobacter cryoconitis: AY601_4696Help
Entry
AY601_4696        CDS       T04341                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00020  Citrate cycle (TCA cycle)
pcm00310  Lysine degradation
pcm00380  Tryptophan metabolism
pcm01100  Metabolic pathways
pcm01110  Biosynthesis of secondary metabolites
pcm01120  Microbial metabolism in diverse environments
pcm01130  Biosynthesis of antibiotics
pcm01200  Carbon metabolism
Module
pcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AY601_4696
  09105 Amino acid metabolism
   00310 Lysine degradation
    AY601_4696
   00380 Tryptophan metabolism
    AY601_4696
Enzymes [BR:pcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AY601_4696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AMQ01526
UniProt: A0A127VJL8
Position
5480906..5482138
Genome map
AA seq 410 aa AA seqDB search
MSLEIKVPPVGESITEVVLSRWVKNDGDAVEMDEVIAELESDKATFELTAEQAGTLKIVA
AEGDTLVIGAVVCSIETSGAAPAKAAAPAAEEKAVVNDAQPAAPVAERNGESYATGTPSP
AAGKILAEKGVDAAAVKGSGVDGRITKDDALKAEKAAAPAAKAPEKAAPTVAAPVAGSRN
ERKEKMSPLRKTVAKRLVAVKNETAMLTTFNEVNMKPIMDLRGKYKDQFKEKYGVGLGFM
SFFTKAVCEAMKDFPAVNARIDGESVVYNDFVDISIAVSAPKGLVVPIIRNAESMTLAQI
EKSVIELATKARDSKLTLEEMTGGTFTITNGGVFGSMMSTPIINAPQSAILGMHNIIERP
IAEKGEVVVRPMMYLALSYDHRIIDGRESVGFLVRVKQLLEDPARLLLGI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagaaataaaagttccgccagtaggcgaatcaattaccgaagttgttttatcc
cgttgggtgaagaatgatggtgatgccgtagaaatggatgaagtaatcgccgagttagaa
tctgataaagcaacttttgaattaactgctgagcaagccggaactttgaaaatagtggcg
gccgaaggcgatacgctggttataggtgctgtagtttgttctatcgaaactagtggggct
gctccggcaaaagcggcagcgccagctgctgaagaaaaagcggttgttaatgatgctcag
cctgctgctccggtagcggaaagaaatggcgagagttatgcaactggtactccttcaccg
gcagcaggtaaaattcttgcagaaaaaggtgttgacgcggcggctgttaaaggctctggt
gttgatggcaggattactaaagatgatgcgcttaaggcggagaaagcggctgcaccagca
gctaaggctcctgaaaaagctgcaccaactgtagctgcaccggttgcaggttcaagaaat
gaacgcaaagaaaaaatgtctccattgcgcaaaactgttgcgaaacgtttagttgcagtg
aagaatgaaacggccatgttaactacttttaatgaagtaaacatgaaaccgatcatggat
cttcgtggaaaatataaagatcagttcaaagaaaaatatggtgttggtttaggtttcatg
agtttcttcacgaaagctgtttgtgaggcaatgaaagatttccctgctgtgaatgcacgt
attgatggtgaatctgttgtttacaatgacttcgtagatatttctatcgctgtttctgca
ccaaagggattggttgttccaattatcagaaatgcagagagtatgacacttgcccagatt
gaaaagtctgtgattgagttggctactaaagcacgtgatagcaagttgactttggaagaa
atgactggtggaacatttacaattactaatggtggtgtatttggttcaatgatgtctacg
ccaattatcaatgcgcctcagtctgcgattttaggaatgcacaatattattgagcgccct
attgcagaaaaaggtgaagttgtggtccgcccgatgatgtatcttgctttatcttatgat
cacagaatcattgatggcagagagtctgttggattcctggtaagagtaaaacagttgtta
gaagatcctgcacgtttgttgttagggatttaa

DBGET integrated database retrieval system