KEGG   Propionibacterium acnes 6609: TIB1ST10_05915Help
Entry
TIB1ST10_05915    CDS       T02065                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00340  Histidine metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01230  Biosynthesis of amino acids
Module
pcn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TIB1ST10_05915 (hisD)
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TIB1ST10_05915 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh POTRA_3
Motif
Other DBs
NCBI-ProteinID: AEH29476
Position
1253661..1254962
Genome map
AA seq 433 aa AA seqDB search
MTSETTDDLRCAVPRADFDVDAAMAAVIPVCSAVRDRGVEALREYSEKFDHVVPEHLRVP
VEALATAAANLDGTLRRAFSESIRRRRQVCQEAEVETSSQPVEVAGGARVSQRIVPVGRV
GLYVPGGFAPLASSVIMNVVPAQEAGVSSIAVASPPQAEFGGLPHPSILALCHLLGVNEV
YAVGGAQAIAMFAYGVEGSDEADSCPRVDMVTGPGNIYVVAAKRCLRGTVGIDSEAGPTE
IAILADETADPRHIAADLMSQAEHDTLAAAVLVTDSTTLAEAVQRELAPMVSATLHSERI
RTSLTSKQSAIVMVRDIDQGLEVVNAYAAEHLEIQTADAAAVAARVWNAGAIFVGPWAPV
SLGDYSAGSTHVLPTAGAACHSSGLSVRSFMRAVHVIDYTEDALLELADSVEAFALAENL
PGHANAITVRRSR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtgagaccactgacgacctgcgttgcgccgtgcctcgcgcggacttcgatgtc
gatgccgccatggcggccgtcatccctgtctgctccgcggtgagggatcgtggcgttgag
gcgctacgtgagtacagcgagaaattcgaccatgtggttcccgagcatctgcgcgttccg
gtcgaggctctcgccacggcagctgcgaacctcgacggcaccttgcgtcgggctttcagc
gaatctattcgacgtcgtcgtcaggtatgtcaggaagctgaggtggagacctcgtcccaa
ccggttgaggtggcaggtggcgcgcgggtgagccagcgcatcgtcccggtcgggcgtgta
ggcctttacgttccgggtgggttcgctccgctggcatcgtcggtcatcatgaacgtcgtt
cctgcgcaggaggccggtgtctcgtctatcgctgtagcatctccgccccaggcggagttt
ggtgggttgccgcacccgagcatcttggcgctgtgtcatctactgggtgtcaatgaggtc
tacgccgttggtggcgcccaggcgatcgccatgttcgcttacggtgttgagggctccgac
gaggcagattcctgtccgcgcgtcgacatggttacgggtccaggcaacatctacgtagtc
gcggcaaagcgctgcctgcgtggcaccgtcggcatcgattcggaggctgggcccaccgaa
atcgccatcctggccgatgagactgctgacccgcgtcacattgctgctgatcttatgagc
caggctgagcacgacacgctggctgccgcagtgcttgtcacagactcgaccacactggcc
gaagctgtgcaacgagaacttgccccgatggtcagtgccaccttacattccgagcgcatt
cgcacctcgctgacatccaagcagtcggccatcgtcatggtacgtgatattgatcagggc
ctcgaagtggtcaatgcgtatgccgccgagcatctcgagatccagacggccgatgctgcc
gcagtcgctgctcgggtctggaacgctggcgccattttcgtcggcccatgggcgcctgtc
tctcttggggattactcagccggatccactcacgtccttcccacggcaggagcagcctgc
cactcgtctggtctgtcggtgcgttccttcatgcgcgccgtccacgtgatcgactacacc
gaggatgccctactcgaactggccgattccgttgaggcttttgccttggcggagaatttg
cccggccatgccaatgccatcactgtgaggaggtcacgttga

DBGET integrated database retrieval system