KEGG   Propionibacterium acnes 6609: TIB1ST10_09020Help
Entry
TIB1ST10_09020    CDS       T02065                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00020  Citrate cycle (TCA cycle)
pcn00640  Propanoate metabolism
pcn00660  C5-Branched dibasic acid metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
Module
pcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIB1ST10_09020 (sucC)
   00640 Propanoate metabolism
    TIB1ST10_09020 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TIB1ST10_09020 (sucC)
Enzymes [BR:pcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TIB1ST10_09020 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A ATP-grasp SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AEH30076
Position
complement(1916400..1917575)
Genome map
AA seq 391 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLRGIVAETPEQASEAAAKLGTPVVAVKAQVKVGGRGKAGGV
KIAKSPAEAAERAEAILGMDIKGHTVHKVMVAEGADIAEEYYFSILLDRGERRYLAMCSR
EGGMDIETLAKERPEALAKVPVDPIDGVDDAKAREILSEAGFPDSEQDAIVPAVLKLWET
YRDEDATLVEVNPMIKTGDGRILAIDGKMTVDNNASFRQPDHAGLVDRATTDPLELRAGE
LGLNYVKLDGNVGVIGNGAGLVMSTLDCVAYAGENFPGSPAPANFLDIGGGASAEIMANG
LDLIMSDEQVRSVFVNVFGGITACDQVALGIKGALEKLGDKAVKPLVVRLDGNAVAEGRK
ILEEFNYPLVTMVSTMDEAASKAAELASKEA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaagcccgcgacctgtttgagaagcacggcgtgcccgtactt
cgaggcatcgtcgcggagactccagagcaggcgtccgaggctgcagcgaagctcggtacc
cccgtcgtcgccgtcaaggcgcaggtcaaagtgggtggccgtggcaaggctggcggtgta
aagatcgctaagtccccggccgaggcggctgaacgcgccgaggccatcctcggtatggac
atcaagggtcacaccgttcacaaggtgatggtcgctgaaggtgctgacattgccgaggaa
tactacttctcgatcttgctcgaccgtggagagcgtcgctaccttgcgatgtgctcgcgt
gagggtggcatggacatcgagacccttgctaaggagcgccccgaggctctcgccaaggtg
ccggtcgacccgattgacggcgttgacgatgctaaagcccgcgagatccttagcgaggca
gggttccccgactctgagcaggacgctatcgtcccggctgttctcaagctgtgggagacc
taccgtgacgaggatgccaccctcgtcgaagtcaacccgatgatcaagaccggcgatgga
cgcatcctggctatcgacggcaagatgactgttgacaacaacgcgtccttccgtcagcct
gaccatgccggcctggtggatcgcgccaccaccgacccgctcgagttgcgtgccggcgag
ctcggtctcaactacgtcaagctcgacggcaacgtcggcgtcatcggaaacggtgctgga
ctggttatgagcacccttgactgcgttgcttacgccggtgagaacttcccgggatctccg
gctcccgctaacttcctcgacatcggtggcggcgcctcggccgagatcatggccaacggc
cttgacctcatcatgagtgacgagcaggtgcgttccgtgttcgtcaacgtctttggcggt
atcaccgcctgtgaccaggtggcgcttggtatcaagggcgctctcgagaagttgggcgac
aaggccgtgaagccgctcgtcgtccgtctggacggcaacgctgtggccgagggccgcaag
attctcgaggaattcaactacccgctcgtgaccatggtctcgaccatggacgaggccgcc
agcaaggccgccgagctcgcatccaaggaggcctga

DBGET integrated database retrieval system