KEGG   Cutibacterium acnes 6609: TIB1ST10_10385Help
Entry
TIB1ST10_10385    CDS       T02065                                 

Definition
(GenBank) putative low-affinity phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pcn  Cutibacterium acnes 6609
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TIB1ST10_10385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEH30347
Position
complement(2216048..2217193)
Genome map
AA seq 381 aa AA seqDB search
MSSTLLIVVIVVVTALAFDFTNGFHDSANAMATSVATGALKPKVAVIIAAVLNVIGACLS
TEVAKTISGGIVNDHLVTAPMVFAGLIGAIIWNLATWLFGLPSSSSHALFGGLIGAVLVE
AGMSGIDAGKIMSKIVLPALVAPFVAGIAALVATWLAYRITNHTAHHSSRMFLNGQRVSA
SMVALAHGTSDGQKTMGIITLVLISAGYQASGTGPEWWVILAAGCAIGLGTYSGGWRIMR
TMGKSLCDIESPQGFAAETASTAAILASSHLGFALSTTHVCSGSILGSGIGRHTEVRWAT
AGKMVIAWLVTLPAAALVGAVTSAVAGAGTWGVIVDLGLLAVMAALIVRQANQHKVDHRN
VNDSTQVGVRKGSAVAGGTAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgactctgttaatcgtggtcatcgtcgttgtgacggcgttggcattcgacttc
actaacggcttccacgactcagccaacgctatggcaacgtcggtggcaaccggggcactc
aagcccaaggtggccgtcatcatcgcggctgtgctcaacgtcattggcgcgtgcctgtcg
actgaggtcgccaagacgatctcgggcggtatcgtcaacgatcacctggtgaccgctccc
atggtctttgctggacttatcggtgccatcatttggaatctggcaacgtggctgttcggt
ctgccatccagctcctcccatgctctctttggtggccttatcggtgctgtgttggttgag
gctggtatgagtggcatcgacgctggcaagatcatgagcaagatcgttctaccggctttg
gttgccccttttgttgcgggtatcgcggccttagtggccacgtggctggcttaccgcatc
accaaccacactgcccaccactcttcgcggatgttccttaacggccagcgggtctcagct
tccatggtcgctctcgcgcatggcacctctgatggccaaaagacgatgggcatcattacc
ctggtcctcatttccgctggataccaggcctccggcactggcccagagtggtgggtcatc
ctggctgcggggtgcgccatcggtctaggtacctactcgggtggttggcgcatcatgcgg
accatgggcaaaagtctatgtgatatcgagtctccgcagggttttgcggctgagacggcc
tccactgccgcgattctggcctcttcgcacctgggcttcgccctgtcgaccacccatgtc
tgttcgggatcgattctgggctcgggtatcggccgtcacactgaggttcgctgggccacc
gctggaaagatggttatcgcgtggctcgtcacgctgccggcggccgctctcgttggtgcc
gtcacctcagccgtcgccggtgccggcacttggggcgtcattgtcgacctcggcttgctg
gctgtcatggccgcactgattgtccgtcaggccaaccagcacaaggttgaccataggaac
gttaatgactccacccaggtgggcgtccgtaagggctccgccgtagccggagggactgca
gcatga

DBGET integrated database retrieval system