KEGG   Cutibacterium acnes 6609: TIB1ST10_11615
Entry
TIB1ST10_11615    CDS       T02065                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pcn  Cutibacterium acnes 6609
Pathway
pcn00472  D-Arginine and D-ornithine metabolism
pcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TIB1ST10_11615
Enzymes [BR:pcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TIB1ST10_11615
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AEH30590
Position
2470951..2471373
AA seq 140 aa
MSNPDQERVERYEALRTELADLDDAALKERFWQLCEEVMTPVVDLARTHTTPSIERSVLL
RMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGIGLRDAATRIAEDPKALDELFD
GSPLPPAKTPTTDSKEGASA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtccaacccggatcaggagcgcgtcgaacgctacgaagctctgcgcaccgaactcgcc
gatctcgacgacgccgccctcaaggaacgcttctggcaattgtgcgaagaggttatgacc
ccggtcgttgacctcgcccgcacccacaccaccccgtccattgaacggtccgtcctactg
cgcatgggcatcgactcggtgacaacccacgccgtcgtggagaacgtgttcgcagcaggc
ctgggtggcaaaggggctggccacgccgtgctgcgactatcacgtcgtgacggcattggt
ctgcgtgacgcagctacccgcatagccgaggaccccaaggccctcgacgaactattcgac
ggcagcccgctgccacctgcaaagacaccgaccacggattccaaggaaggagcctcggca
tga

DBGET integrated database retrieval system