KEGG   Phanerochaete carnosa: PHACADRAFT_127059Help
Entry
PHACADRAFT_127059 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pco  Phanerochaete carnosa
Brite
KEGG Orthology (KO) [BR:pco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PHACADRAFT_127059
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PHACADRAFT_127059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 18908066
NCBI-ProteinID: XP_007399288
JGI: Phaca1_127059
UniProt: K5VXE1
Position
Unknown
AA seq 740 aa AA seqDB search
MAASSSADVIVLSVGIVLAALYLFREQLFAASKPKSVQVPSSKASAATAASGNGNPRDFV
AKMKEGKKRIVIFYGSQTGTAEEYAIRLAKEAKSKFGLASLVCDPEEYDFENLDQIPEDC
CVFFVVATYGEGEPTDNAVQLCQNLPDESFEFSNGEHKLPGLKYVIFGLGNKTYEHYNII
SRNIDRDLEKMGATRIGERGEGDDDKSMEEDYLEWKDGMWEAFAKAMNVEEGQGGDSPDF
AVTEVYDHPQEKVYLGELSARALTRTKGIHDAKNPYPAPIIAAKELFAPGADRNCVHIEI
STEGSGITYQHGDHLGVWPSNADKEVDRLLYALGLYEKKDTVINIESLDPALAKVPFPVP
STYDTVLRHYIDISALTGRQILGALSKFAPTPEAESTLKDLNGNKERYQSIVANGCMKLG
EVLQYAAGNDLHAAPNASNTTAWTIPFDIIVSSIPRLQPRFYSISSSPKLYPNSIHATVV
VLKYKSDRAQRVDSRWIYGVGSNFLLNLKYASHHNKTPPLVSDESNEEPSLVSHYPTYSI
EGPRGAYKQDDIVKVPIHVRRSTFRLPTNPKSPVIMIGPGTGVAPFRGFVQERVAMARRT
IEKNGPEGLADWGPIRLYFGCRYSNQDFLYKDEWPEYAKELHGKFVMRCAFSREPPYKPD
GGKIYVQDLIWEDAEQIADAILNGKGYVYVCGDAKSMSKSVEETLCRILGEAKGGSAEVE
GAAELKLLKERNRLLLDVWS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctcttcgtctgcggacgtcatcgttctgtccgtcggcatcgtcctcgctgcg
ctctatctcttccgcgagcagctctttgctgcgtcaaagcccaagtctgtccaggtaccc
tcgtcaaaagcttccgccgctactgctgcttccggcaatggaaatcctagagattttgtc
gcaaagatgaaagaagggaaaaagcgcatcgtcatcttctacggctctcaaactggcact
gcggaagagtacgctattcgtctcgcgaaggaggcaaagtccaagttcggtctggcctcg
ctcgtatgtgaccccgaggaatacgacttcgagaaccttgaccagattcctgaggactgc
tgcgtcttcttcgtcgtggctacttacggtgagggcgagcccacggacaacgcagtgcaa
ctctgccagaacctgccggatgagtctttcgagttctcgaatggcgagcacaagcttccc
ggtcttaagtacgttattttcggtctcggcaacaagacatacgagcactacaacattatc
tcgcgcaatatcgatcgtgacctggagaagatgggtgctacccgcattggcgaacgtggc
gagggtgacgacgacaagagcatggaggaggattatctagagtggaaggacggcatgtgg
gaggcatttgccaaggccatgaacgtagaggaaggccagggcggcgactcgcccgacttt
gccgtaaccgaagtctatgatcacccgcaggagaaggtctaccttggcgagctgtctgct
cgggctctcacacgtaccaagggcatccatgatgcaaagaacccttatcctgcgcccatc
atcgctgctaaggagctcttcgcccctggtgcggatcgtaactgcgtccacatcgaaatt
agtacggagggctcgggtatcacttaccaacatggagaccatctcggtgtttggccgtct
aatgcggataaagaggtcgaccgccttctctacgctctcgggctgtatgagaagaaggac
accgtcatcaacatcgagtcgctcgatcctgctcttgccaaggttccgttcccggttccg
tccacctatgacactgtccttcgccactacatcgacatcagcgctctcacaggccgtcag
attctgggtgcgctttcgaagtttgcgccgacgcccgaagcggagtcaactctcaaggac
ctgaacggcaacaaggagcgctatcagagtatcgtcgccaatgggtgcatgaagctcggc
gaggtccttcagtacgctgccggcaacgacctccatgcggccccgaacgcttcgaacact
acggcttggactatccctttcgacatcatcgtctcctccattccgcgtttgcagcctcgg
ttctattcgatctcgtccagccccaaactgtacccgaactccatccacgctactgtcgtc
gtcttgaagtacaagtccgatcgggctcaacgtgtcgactcccgctggatttatggtgtt
ggttccaacttcttgctcaacctcaaatacgcctcgcaccacaataagacgccgcctctc
gtcagcgatgagtccaacgaggagccttcccttgtgtcgcattaccctacctattctatt
gagggtccgcgcggagcatacaagcaggacgatattgtaaaggttcccatccacgtccgc
cgctcgacgttccgtctgccgacgaacccgaagagcccagtcattatgattggtcctggc
acgggtgttgcgccattccgcggtttcgttcaggaacgtgttgctatggcccggcgcact
atcgagaagaacggccctgaaggtctcgcagattggggaccaatccgcctctacttcggc
tgccgctactctaaccaagactttttgtataaggatgagtggccggagtacgccaaggag
ctccatggcaagttcgtcatgcgctgcgcattttcccgtgagccgccgtacaagcccgac
ggcggcaaaatctacgttcaagacctcatatgggaggatgccgagcaaattgcggatgcg
attctcaacggcaagggttacgtctacgtttgcggcgatgcaaagagcatgagcaagagc
gtcgaggagaccctatgccgcatccttggagaggctaagggtggctcggctgaagtggaa
ggcgcagcagagctgaagcttctcaaggagcgcaaccgcctgctgttggatgtctggtca
taa

DBGET integrated database retrieval system