KEGG   Phanerochaete carnosa: PHACADRAFT_167159Help
Entry
PHACADRAFT_167159 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
pco  Phanerochaete carnosa
Pathway
pco00010  Glycolysis / Gluconeogenesis
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHACADRAFT_167159
Enzymes [BR:pco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     PHACADRAFT_167159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C DUF362
Motif
Other DBs
NCBI-GeneID: 18909371
NCBI-ProteinID: XP_007401868
JGI: Phaca1_167159
UniProt: K5UJU8
Position
Unknown
AA seq 549 aa AA seqDB search
MLQSQAQQTVEVSVGRVCTIAEYLLERLVQLNVTSIFGVPGDFNLAFLDYIESHSKLGWV
GNCNELNAAYAADGYARVKEGSIGVVVTTFGQKNKLVLHHTFGDGRYDMYFKAAQQVVIS
HASLQDKATAAAEIDRVITDCVLMARPVYLVLPTDLVSAQIPAERLQTPLNTEPPQNDPE
TESVVLDEIVKLIEEAERGVIILVDACSIRRNVKDEVFEFAKKTRFPVYSTPMGKTAIPE
DYELHGGIYAGVTSRPEVKAKVESAKLIISVGGLKTNFNTGNFTNKISPAQTVELHSDHT
RIRLATYHGIGMKHLLPKLTERMQPFKEDVKAIDVPEFTLPVSQEDNDKISHLWLWPRLG
QFFKKGDIIVAEAGTAYFGALEIPMPGGSVFMSQFLWCSIGWTVGSTLGAAIAARDMGLP
RVILFVGDGSIQMTAQELSTMIRYGVKPIIFVLKNNGYTAERYLHDENAQYNDIATWQGF
FLPPMGGTEGETCQSYTVRTKNELSQLLDNVEFAKAEKIQLVEPLMDTHDAPRVLKVLAA
LLKKAKLEE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctccaatcccaagctcagcagacggtggaggtgtccgtcggccgagtctgcacgatc
gcggagtaccttctcgagcgactcgtgcagctcaacgttacaagcatctttggggtgccc
ggagatttcaacctcgccttcttggactatatcgaatcgcactccaagctcggatgggta
ggaaactgtaatgaacttaacgcggcatatgcggccgatggctacgcccgagtgaaggaa
ggcagcattggcgtggtcgtcaccaccttcggccagaaaaacaagctcgtgcttcatcac
accttcggtgacggccgctacgatatgtatttcaaggccgcccagcaggtcgttatctcg
catgcctcgctccaagacaaggctaccgcagctgccgagattgaccgcgtcatcaccgat
tgcgtcctcatggcacgcccagtgtatctcgtactcccgaccgatctcgttagcgcgcaa
atcccggcagagcgcctccagactccgctcaataccgagccgccacagaacgatcccgag
accgagagcgtcgtgcttgacgagattgtcaagctcatcgaggaggcagagcgtggtgtc
atcatcctcgtcgatgcctgttcgatcaggcgcaacgtaaaggacgaagtcttcgagttc
gcaaagaagacgcgtttccccgtttactctactccaatgggcaagactgcgattcctgag
gactacgagctccatggtggcatatatgccggagtgaccagtcgaccagaagttaaggcg
aaggttgagagcgcgaagctcatcatttctgttggcggtctgaagactaactttaacact
ggcaacttcacaaacaaaatctcgcccgcccagaccgttgagcttcattctgatcatacc
cgcatccgccttgccacataccacggcattggcatgaagcatctgctgcccaaactgacg
gaacgcatgcagcccttcaaagaagatgtcaaggcaatcgacgtccccgagttcacgctc
cctgtttcgcaagaggacaacgacaagatctcgcacctctggctctggccacgcctcgga
cagtttttcaagaagggcgacatcatcgtggctgaggctggcacggcctatttcggcgcc
cttgagattcccatgcccggcggctcagtctttatgtcgcagttcctctggtgcagcatc
ggatggaccgtcggcagcacgctgggcgccgccatcgctgcgcgcgacatgggccttcct
cgagtcatcctgttcgtcggggacggtagcatccaaatgacggcgcaggagctctcgacc
atgatacgttacggcgtcaagcccatcatcttcgtgctcaagaacaacgggtacaccgcc
gagcggtatctacatgacgagaacgcgcagtacaacgatattgccacctggcaaggcttc
ttcctcccgcccatgggtggcactgagggcgagacctgtcagtcttacactgtaaggacc
aagaacgagctgtcgcagctgctcgacaatgtcgagtttgccaaggccgagaagatccag
ctcgttgagccgctgatggacacgcatgatgctccccgtgtgctcaaggtcttagccgcg
ctccttaaaaaggcgaaacttgaagagtag

DBGET integrated database retrieval system