KEGG   Phanerochaete carnosa: PHACADRAFT_180382Help
Entry
PHACADRAFT_180382 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pco  Phanerochaete carnosa
Pathway
pco00020  Citrate cycle (TCA cycle)
pco00640  Propanoate metabolism
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
Module
pco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHACADRAFT_180382
   00640 Propanoate metabolism
    PHACADRAFT_180382
Enzymes [BR:pco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PHACADRAFT_180382
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PHACADRAFT_180382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 18909952
NCBI-ProteinID: XP_007390666
JGI: Phaca1_180382
UniProt: K5WBA3
Position
Unknown
AA seq 330 aa AA seqDB search
MFRRAGQSLAYAGRRTFSQSAARQNYEATIQNLLIHKDTRVLCQGLTGKTGTFHVKEALE
YGTNMVGGVSPSKAGQTHLGLPVFGSVREAVREVKPDATVLYVPPPTAADAIIEAIENEI
KLIVCITEGIPQQDEIKVMNALKSQSKSRLVGPNCPGVINPLGCKMGIQPGHIHKPGKIG
IVSRSGTLTYEAVAQTTDVGLGQSLCIGIGGDPFPGTKHVDAIKLFLEDPNTEGIVLIGE
IGGSMEEEAAEYLEKYNKTRPNPKPVVGFIAGRTAPPGRRMGHAGAIISGGKGAASDKVA
ALQKAGAVVTDSPAKIGSAMLQAMKAAGLA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgcgcaggacagtcgctagcgtacgctggccgacggacattctcgcaatct
gcggcgcgacagaactacgaggctactattcagaacctcctcatccataaggacacaaga
gtcctctgtcagggattgaccggaaagactggtactttccacgtcaaggaagctctcgaa
tatggtaccaacatggtcggaggtgtctcacccagcaaggctggacagacccatctcgga
ctccccgtctttggctcagtcagggaggctgtgcgcgaagttaagcccgacgcgactgtg
ctctacgttcctccacccactgctgccgatgctatcattgaggcaattgagaatgaaatc
aagcttattgtatgcattaccgaaggcattcctcagcaggatgaaattaaggtgatgaac
gcgctgaagagccaatcgaaatcgcgtctcgtcggccccaactgccctggtgttatcaat
ccccttggctgcaagatgggtatccaacctgggcacatccacaagccaggcaaaattggc
atcgtctcgcgctcaggcaccttgacatacgaagccgttgcgcaaactactgatgtaggc
ttgggccagtcgctatgcatcggcattggcggcgatcccttccccggcaccaaacacgtc
gacgcgatcaagctgttccttgaagatcctaacaccgaaggtatcgtcctcattggtgag
attggtggatctatggaggaggaggctgcggagtatcttgagaagtataacaagactcga
ccaaaccccaaacccgttgttggctttattgctggccgcactgctcctcccggtcgccgc
atgggccatgccggcgctattatttctggtggcaagggtgctgcttcggacaaagttgcc
gctcttcaaaaagccggtgctgttgtcacagatagcccagctaagattggctctgcgatg
cttcaagctatgaaggctgctggtctcgcatag

DBGET integrated database retrieval system