KEGG   Phanerochaete carnosa: PHACADRAFT_182112
Entry
PHACADRAFT_182112 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pco  Phanerochaete carnosa
Pathway
pco00910  Nitrogen metabolism
pco01100  Metabolic pathways
Module
pco_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pco_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PHACADRAFT_182112
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PHACADRAFT_182112
SSDB
Motif
Pfam: Pyr_redox_2 Rieske_2 Fer2_BFD Pyr_redox NIR_SIR_ferr Rieske NIR_SIR Rubredoxin_C K_oxygenase
Other DBs
NCBI-GeneID: 18910066
NCBI-ProteinID: XP_007392961
JGI: Phaca1_182112
UniProt: K5WEV7
Position
Unknown
AA seq 1139 aa
MAVDVVPPEQRKTVFVVGLGMVGIAFIEKLLNLDTRMKYKVVTCGEEMHLAYNRVALTDY
FQHRNVEKLYLNQPDWYAAQDPSRFQFHVGEAAISIDTQGHTVTTDKGRTIPYDMCVLAT
GSDATLPSFVNSSVKGIFVYRNISDLNKLLEYSQTDTVKGQPAAVVGGGLLGLEAAKALY
DLEEVGTVSIIHRQTYPLSRQLDAAGGEIVLRRIEALGVQVLGNVSPKSITTETADGEEV
LTGVELGNGTVVPCRIAVFSVGIRPRDELAIAAGIACEGDNAGGRGVVVDDLLQTSAPDV
YAIGECASWQGQTYGLIAPGIEMADILSFNLTQTATAVGGFAPRKMNNPDLSTKLKLVGV
DVASFGDYFADRRQAEDGPSPRSTAYSVRKPAPATSAPLSHDQRDPFKGKVWEVKESAAE
PVSAAPTLTVTAPADDASSVQNGSGVDGKENGEVQRRADASAPRKRHGHAAATEGPVETL
TYRDPFGGVYKKYIFSADGKYILGGMMVGDTNDYVKLLALVKKKKPLEVPPSQFIAGSGG
GDDSGEDLDDDTQICSCHNVTKGQLAACVKNGVDSLNDIKQKTKAGTGCGGCMPLVTNIF
KSEMRKSGLEVSNNLCPHFAMTRAELFNVVKIKKLKTFTEIMASSGVNKDAVGCEICKPA
VGSILASLYNEHIMNPVHHANQDTNDRFMANIQRNGTFSIIPRIAAGEITPDKLIVLGQV
AKKYGLYTKITGGQRIDLFGAQKADLPSIWKELVDAGFESGHGYGKALRTVKSCVVAIAL
EERYKGIRAPHKFKGGVSGCGRTFGLIATDKGWNIFICGNGGANPRHATLFATDVPPSHA
IRIVDRFLMYYIRTADKLMRTARWVEQMDGGIERLKKILLEDELGICADLEREMDELVGT
YYDEWAIVANDPERQKQFRQFVNTPQRVQTVEPVVERGQPRPADWAKTSPAVHLKASDIP
APKETWQWRKLARVDDLTPTDAGTTSAAVKYGESQLAIFHVPRRGYFCTQQMCPHKRAFV
LEHGLIGDDPNTGNLYISCPMHKRNFSLTSGACLNDDNYSIIAFDVRVEDDEISVLLPEE
KDLDAVIATHRWMVKRDTAQALDGDARTKESSAVEIVGPKDEVVGAGCESACGDSKLEW
NT seq 3420 nt   +upstreamnt  +downstreamnt
atggccgtagatgtggtacccccagagcagcgcaagaccgtctttgtggtcggtcttggc
atggtcggcattgcttttattgaaaagctgctcaatctcgatactcggatgaagtacaag
gtggtgacatgcggagaggagatgcacctggcatacaaccgagtcgctctgactgactac
ttccaacaccgcaacgtcgagaagctgtacctcaatcaaccggactggtatgcggcacaa
gatccatcccgcttccagttccatgtcggcgaagcggccatctctattgatacccaggga
cacacagtgactacagacaagggcagaacaataccgtacgacatgtgtgtcctcgccacc
ggctccgacgccactctaccgagttttgtgaactcttccgtcaaaggcatcttcgtgtac
cgcaatatctcggatctcaacaaactccttgaatattcccagacggacaccgtgaaaggg
cagcccgcagcagtcgttggcggaggcctgctcggcttggaggccgccaaagccctatac
gacctcgaggaagtcggaaccgtctccatcattcaccgccaaacgtacccgctctctcgt
cagctggacgcagcgggcggcgagatcgtcctgcgtcgtatcgaggcgctcggcgtccag
gtcctcggcaacgtctcgcccaagtccatcacgaccgagaccgcagacggcgaggaggtg
ctcacgggcgtagagctcggcaacggcaccgtcgtgccctgccgcatcgcggtcttctcc
gtcggcatccgcccgcgcgacgagctcgcgatcgcggcgggcatcgcgtgcgagggagac
aacgccgggggccgcggcgtcgtcgtcgacgacctcctgcagacgagcgcgccggacgtg
tacgcgatcggcgagtgcgcgtcgtggcagggccagacgtacgggctcatcgcgcccggc
atcgagatggcggacatcctctcgttcaacctcacgcagaccgcaaccgcggtcggcggg
ttcgcgccgcggaagatgaacaatccggacctgtcgacgaagctcaagctcgtcggcgtc
gacgtcgcgtccttcggcgactacttcgcagaccggcgccaagcggaggacggcccgtcg
ccccggagcacggcgtacagcgtccgcaagcccgcgcctgcgacgagcgcgccgctctcg
cacgaccagcgcgacccgttcaagggcaaggtctgggaggtcaaggagagcgccgcggag
cccgtcagcgcggcgccgacgctcactgtcacggcgccggcagacgacgcctcgtcggtg
cagaacggctcaggggtggatgggaaggagaatggggaggtgcagaggcgcgcggacgcg
tccgcgcccaggaagaggcacggacacgctgcggccacggagggccccgtcgagacgctg
acgtaccgcgacccgttcgggggcgtgtacaaaaagtacatcttcagcgcggacgggaag
tacatcctcggcggcatgatggtcggcgacacgaacgactacgtcaagctcctggcgctg
gtcaagaagaagaaaccacttgaggtcccgccgtcgcagttcatcgccgggtctggcggc
ggcgacgattcgggcgaagatctggacgacgacacccaaatttgcagctgccataacgta
acaaagggtcaactggcggcttgcgtgaagaatggtgtcgactccctgaacgacatcaag
caaaagacaaaggccggcaccggatgtggcgggtgcatgccgctcgtaacaaacatcttc
aagtcggagatgcgcaagagcggactggaggtcagcaacaatctctgcccacactttgcc
atgacgcgcgcagagctgttcaacgtcgtcaaaatcaaaaagctcaagaccttcaccgag
atcatggcatcgtccggcgtcaacaaagacgccgtcggctgcgagatttgcaagcctgca
gttggtagcatacttgcatcgctgtataacgagcacatcatgaacccagtgcaccatgcg
aaccaagacacgaacgaccggttcatggccaacatccagcggaacggcaccttctccatc
atcccgcgcatcgcggccggcgagatcacgccagacaagctgatcgtgctcggccaggtc
gcgaagaagtatggcctctacacgaagatcaccggcggccagcgcatcgacctctttggc
gcgcagaaggcggaccttccctccatctggaaggagctcgtcgacgccgggtttgagagc
ggccacgggtatggaaaggcgctccgcacggtcaagtcgtgtgtcgtggcgattgccctc
gaggagcggtacaagggtatccgcgcgccgcacaagttcaagggcggcgtcagcggatgc
ggaaggacttttggtctcatcgcaactgacaagggatggaacatcttcatctgcgggaac
ggcggcgcgaacccgcgacatgccacgctttttgcgacggacgtcccaccgtcgcacgcg
atacgcatcgtcgaccgcttcctcatgtactacatccgcaccgcggacaagctcatgcgc
actgcgcggtgggtggagcagatggacggcgggatcgagaggctgaagaagatccttctc
gaagacgagttgggtatctgcgcggacctggagcgcgagatggacgagctcgtggggacg
tactacgacgaatgggccattgtcgcgaacgaccccgagcgccaaaagcagttcaggcag
ttcgtgaacacgccacaacgcgtgcagacagtagaacctgtcgtggagcgtggacaaccg
cgtccggcagactgggcgaagacgagtccggctgtgcacctcaaagcgagcgacatcccg
gcgccgaaggagacgtggcaatggcgcaagctcgcgagagtggatgacttgacacccacc
gatgctggcacaacgtctgctgccgtcaagtatggcgaaagtcagctggccatcttccat
gtgccaaggcgaggctatttctgcacgcaacaaatgtgcccgcacaagcgcgccttcgtc
ctggagcacggcttgatcggggacgatcctaacaccggcaatctctatatctcttgcccg
atgcacaagcggaacttctctctgacatcgggtgcctgtttgaacgacgacaactacagc
atcattgcgtttgacgtccgcgttgaagacgacgaaataagcgtgctcctaccagaagag
aaggacctcgacgccgtcattgcgacgcaccgttggatggttaagcgcgacaccgcacag
gcgctcgacggcgacgcgcgtacgaaagagagcagtgccgtggagatcgtcggtcccaag
gacgaggtggtcggcgctgggtgtgagtcagcatgtggagatagcaagttggagtggtga

DBGET integrated database retrieval system