KEGG   Phanerochaete carnosa: PHACADRAFT_192397Help
Entry
PHACADRAFT_192397 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pco  Phanerochaete carnosa
Pathway
pco00450  Selenocompound metabolism
pco00970  Aminoacyl-tRNA biosynthesis
pco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PHACADRAFT_192397
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHACADRAFT_192397
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pco01007]
    PHACADRAFT_192397
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pco03016]
    PHACADRAFT_192397
Enzymes [BR:pco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PHACADRAFT_192397
Amino acid related enzymes [BR:pco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PHACADRAFT_192397
Transfer RNA biogenesis [BR:pco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PHACADRAFT_192397
 Prokaryotic type
   Other AARSs
    PHACADRAFT_192397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 GSG-1
Motif
Other DBs
NCBI-GeneID: 18910822
NCBI-ProteinID: XP_007392546
JGI: Phaca1_192397
UniProt: K5W7S3
Position
Unknown
AA seq 494 aa AA seqDB search
MTGTDEHGLKIQQAAKAKGLEPQAFCDELSQHFRGLAAKANISHTRFSRTTEKEHYEAVQ
HLWRGLDAKGLIYKGKHEGWYSVTDECFYTDGQVTKVVSSNPEEDQFHISVETGSKVEWT
QEENYKFRLSVFRESLLNHYQQHPDAVYPEQFHADVVATLSVPVEDLSVSRPRSRLSWGI
PVPNDPEHTIYVWIDALTVYLSATGYPWKSDLTSLPEAIWPPNVQIIGKDILRFHAIYLP
AMLQALGLPLSRQLLTHSHWTVGQRKMSKSVGNVADPFEAIDEFGPDVVRYYLARVGGRF
KDDVDWSHSQLEKHFRELMSLLGNTYMRITSKKIMEKVRVVSVEQTVEPFSEHMRTIYNR
LLPGDSSIASAVDQEMSRLKIADALEHIMNLLGQANELMTLTEPWAKDTGLHHTIGVQTI
VLHTLRVCGILLQPFIPSKAEELLDALFIPVSHRTLAYANLGEGRVGGVTPGLRLFNAPR
SGEKAHGTKGRPVE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggacggacgagcatggtttgaagattcagcaagctgcgaaagcgaagggcctc
gaaccccaagcgttttgcgacgagctgtcgcaacattttcgtgggttggccgctaaagcg
aacatcagccatactcgcttctcacgtacaactgagaaggaacactatgaagcggttcag
cacctatggcgtgggttggatgcgaaaggtctcatttacaaaggaaaacacgagggttgg
tactcagttacggatgaatgcttttataccgacggccaagtcacgaaggtggtatcatct
aatccggaggaagatcaatttcacatctccgtcgagacaggctccaaggttgagtggacg
caagaagagaactacaaatttcgcctctcggtctttcgcgaatctctgctaaatcactac
cagcaacaccccgatgccgtctatcctgagcagttccatgcagacgtggtcgcaacactg
tccgttccagtggaagatctctctgtgtcccgcccgcggtctcgcttgtcctggggcata
ccagttccaaatgatcctgagcacacaatctacgtttggatcgacgcgctgactgtgtac
ttgtctgccactgggtatccttggaagtcggaccttacttcattgcccgaagctatctgg
ccgcctaacgtacagatcatcggcaaggacattcttagatttcacgcaatatatctgccc
gcgatgttgcaagcccttggactacctctatcccgacagttacttacccattctcattgg
acggtaggccagcgaaagatgtccaagtctgtaggcaacgtcgcggatccatttgaagct
attgacgagttcggtcctgatgttgttcgatactatctcgcgcgtgtcggagggcgcttc
aaggacgacgttgattggtcgcattcccaactggagaagcactttcgcgaactcatgtct
cttcttggaaacacctatatgcgtatcacgtcgaaaaagatcatggagaaggtccgtgtc
gtctcggtagagcagaccgtggagcccttctccgaacacatgagaactatatataaccgg
ctgttgcctggggactccagcatcgcaagtgctgttgatcaagagatgagccgactcaaa
attgcggacgctcttgagcatattatgaacctcctagggcaggctaacgagctcatgact
ttgactgagccttgggcgaaggacacgggcttacatcacaccataggcgtccaaactatc
gttcttcacaccctgcgtgtttgcggtatcctcctacagccgtttatcccttccaaggcg
gaagagcttctagacgccctctttataccagtatcccaccgcactctcgcgtatgccaat
ttgggggagggccgtgtcggcggcgttacgcccggtctgcgcctcttcaatgcgcccagg
agcggcgaaaaggcgcacggcactaaagggagaccagtagagtag

DBGET integrated database retrieval system