KEGG   Phanerochaete carnosa: PHACADRAFT_257564Help
Entry
PHACADRAFT_257564 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pco  Phanerochaete carnosa
Pathway
pco00010  Glycolysis / Gluconeogenesis
pco00020  Citrate cycle (TCA cycle)
pco00620  Pyruvate metabolism
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
pco01130  Biosynthesis of antibiotics
pco01200  Carbon metabolism
Module
pco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHACADRAFT_257564
   00020 Citrate cycle (TCA cycle)
    PHACADRAFT_257564
   00620 Pyruvate metabolism
    PHACADRAFT_257564
Enzymes [BR:pco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PHACADRAFT_257564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_29
Motif
Other DBs
NCBI-GeneID: 18916886
NCBI-ProteinID: XP_007396710
JGI: Phaca1_257564
UniProt: K5VRA1
Position
Unknown
AA seq 563 aa AA seqDB search
MVYHGSTPYVTPHILHKHYAQSFDAETNSLVGRELEYFSQAGFDMERIQIKRNAPVALLY
EDAIRNEGAIISSTGALINFSGKKTGRSPKDKRIVYEETSKDDIWWGSVNIKLDEHTFEI
NRERAIDYLNTRDNVYVFDGFAGWDPKYRIKVRVICARAYHALFMNNMLIRPTEEELASF
GEPDFTIYNAGQFPANRFTKGMSSTTSVEINFKRMEMVILGTEYAGEMKKGVFSVMHYLQ
PVKFGQLSLHSSANVGMDKGDVTLFFGLSGTGKTTLSADPRRLLIGDDEHVWSDTGVFNI
EGGCYAKCINLSAEKEPEIFNAIRFGSILENVVYNPINRVSDYDDTSITENTRCAYPIEF
IPNAKIPCVVDQQPSNIIMLTCDAFGVLPPVAKLSPEQAQYHFLAGYTSKTPGTEDGVLE
PIPTFSTCYSAPFIALHPGRYAEMLAERMSKHNVDCWLINTGWTGGKFGTGSRCPLKYTR
RIVDAVHSGELAKAEYEAFDVFGLQIPTALEGVPRELLNPRLAWKDSEAFEREVRKLGGM
FRKAFALYERDVDEKVRAAGPQL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggtctaccacggctctactccctacgtgactcctcacatcctccacaagcactatgct
cagtccttcgatgccgagacaaacagcctcgtcggccgtgagctcgagtatttctcgcag
gcaggctttgacatggagcgcatccagatcaagcgcaatgctcctgtcgcactactctac
gaggacgccatccggaacgaaggtgccatcatctcctccaccggcgcgctgattaacttt
tccggcaagaagaccggccgtagcccgaaggacaagcgcatcgtctatgaggagacctcc
aaggacgacatctggtggggatcagtgaacatcaagctggacgagcacacctttgagatc
aaccgtgaacgtgccattgactacctgaatactcgcgacaacgtgtatgtctttgacggc
tttgcagggtgggatcccaagtaccgtatcaaagtccgggttatttgcgctcgcgcctac
cacgcactattcatgaacaacatgttgattcgtccgacggaggaagagctggctagtttt
ggcgagcctgacttcacaatctacaatgccggccagttccctgcgaatcgtttcaccaag
ggtatgtcctcgacaacatctgtcgagatcaacttcaagcgcatggagatggtcatcctg
ggcaccgagtatgccggcgagatgaaaaagggcgtcttctcggtgatgcactacctgcaa
ccagtcaagtttggccagctctccctccactcgtccgcaaatgtcgggatggacaagggc
gacgtcacacttttcttcggtctttccggtaccggcaagaccacgctctccgctgaccca
cgccgcttgctcatcggcgatgatgagcatgtctggtccgacactggcgttttcaatatc
gaaggtggctgctacgccaagtgtatcaacctctctgctgaaaaggagcctgagattttc
aacgccatccgttttggatcgatcctcgaaaatgtcgtctacaaccccataaaccgtgta
tccgactatgacgatacgtccatcacagagaacactcgttgcgcttaccccatcgagttc
atccctaacgcgaagatcccctgcgtagtcgaccagcagcccagcaacatcatcatgctc
acctgtgacgccttcggtgtgctcccgcctgtcgccaagctctcacccgagcaggcacag
taccacttcctggctggctacacctcgaaaacacccgggaccgaggacggcgtgctagag
ccgatcccgacgttctcgacgtgctactcggcaccgtttatcgcgctgcaccccggacgg
tacgcggagatgctcgcggagcggatgtcgaagcacaacgtggactgctggttgatcaac
acgggctggacgggcggcaagttcgggacgggctcgcgctgcccgctcaagtacacgcgc
cggatcgtcgacgccgtgcactcgggcgagctcgccaaggccgagtacgaggcctttgac
gtcttcggcctccagatcccgaccgcgctcgagggtgtcccgcgcgagctcctgaacccg
cgcctcgcgtggaaggacagcgaggcattcgagcgcgaggtgcgcaagctcggcggcatg
ttccgaaaggcgtttgccctgtacgagcgcgacgtcgacgagaaggtcagggcggccgga
ccgcagctgtga

DBGET integrated database retrieval system