KEGG   Phanerochaete carnosa: PHACADRAFT_260019Help
Entry
PHACADRAFT_260019 CDS       T03128                                 

Definition
(RefSeq) carbohydrate esterase family 9 protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pco  Phanerochaete carnosa
Pathway
pco00520  Amino sugar and nucleotide sugar metabolism
pco01100  Metabolic pathways
pco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHACADRAFT_260019
Enzymes [BR:pco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     PHACADRAFT_260019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 NicO
Motif
Other DBs
NCBI-GeneID: 18917595
NCBI-ProteinID: XP_007398275
JGI: Phaca1_260019
UniProt: K5W3T1
Position
Unknown
AA seq 510 aa AA seqDB search
MESENGLICFTNCLLPLEDGSLVEQDLWIDERRGVILDAQRTFFLRRDRPARVIDLGGNI
LSPGYLDIQINGAYGFDFSVFDGDHEAYRNGLRTVAEKIVETGVTSLVPTIITQEKSLYP
ALLHLLRPYSSPNSATMLGWHAEGPFIQMAKRGAHASEFLLKADEGLATFEKIYGAENLV
HQEDWLMACEGQHDSLGVRIITAAPEIAGVRPAMEEATKRGVVFSIGHSIASTDIATAAV
MGGARLITHLFNAMPQLHHRDPCIIGLLGASPHLSFLPPTSPTSPVGPTFQSTGAALSRS
DSSTSLAKRALQAHGDGGAKATSEAFDELVTPPQTPILAPIDTDLHLKKGETTRLSFERP
FYELIVDGIHSHPNSVRLAYSAYPEGCILITDAMKILDPHLKDGVHEWRDGKRFVKEGDK
LYLEGTDTLAGSAVTLDKCVRNFSRFTGCSLGEAIKCATYNPAKCLGIEHRKGTLRPGAD
ADLIVLDRKGYVQSTWVGGKKVWKRQALRI
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggagaacggtctcatctgctttacgaattgcttgctgccgttggaggatggc
agtttggtagagcaggacctctggattgacgagcgcaggggtgttattctggatgcacaa
cgcaccttcttcttgcggcgggatcgtcctgctcgcgtcatcgaccttggaggcaacatt
ttgagcccggggtacctcgacattcagatcaacggtgcctacggtttcgatttctcggtc
tttgacggtgaccatgaagcctaccgcaatggcctcaggactgtcgcagaaaaaattgtc
gagactggtgttacctcgctggttccaactatcatcacgcaagaaaagtcgctataccca
gcgctcctgcaccttcttcgcccctactcttcaccaaactctgccacaatgctcggctgg
cacgccgaaggccccttcatccagatggccaagcgcggtgcccacgcatcagagttcctc
ttgaaggcggacgagggtcttgctaccttcgagaagatctacggtgctgagaatctcgtg
caccaagaggactggctcatggcctgcgagggtcaacacgacagcctcggggtccgtatc
attactgctgctcctgagatcgctggtgtcagacctgccatggaagaagcaaccaagcgt
ggtgttgtcttctcgattggtcacagtatcgcgtcgacagacattgccaccgccgcggtg
atgggcggcgcacggctcatcacgcatctcttcaacgccatgccccagcttcaccaccgc
gacccgtgcatcatcggcctcctcggcgcctccccgcacctctccttcctgccgcccacg
tcgcctacgtcgcccgttggcccgaccttccagagcacaggcgccgcactgtcgcgcagc
gactctagcacgtccctggccaagcgtgccctgcaggcccatggcgacggtggcgcaaag
gcaacctcggaggcgttcgacgagctcgtcacgcccccgcagaccccgatcctcgcgccg
attgatacggacctgcacctcaagaagggcgagacgacgcgcctgtcgttcgagcggccg
ttctacgaactgatcgtcgacggcatccactcgcatccgaactcggtccggcttgcgtac
tctgcgtaccccgagggctgcattcttattacagatgctatgaagatcctcgacccacac
ctcaaggacggcgtgcatgaatggcgtgacggcaagcgcttcgtcaaagagggcgataag
ctctaccttgagggcactgatacgctcgctggcagcgccgtgacgctcgacaagtgcgtc
cgcaacttctcgcgcttcacgggctgctcgctcggcgaggcgatcaagtgcgcgacgtac
aaccctgcgaaatgccttggcatcgagcaccgcaagggcacacttcgtcccggtgcggac
gccgacctcatcgtccttgatcgcaagggctacgtccaaagcacgtgggtcgggggcaaa
aaggtctggaagaggcaggcattgaggatttga

DBGET integrated database retrieval system