KEGG   Phanerochaete carnosa: PHACADRAFT_265128
Entry
PHACADRAFT_265128 CDS       T03128                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pco  Phanerochaete carnosa
Pathway
pco00100  Steroid biosynthesis
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PHACADRAFT_265128
Enzymes [BR:pco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PHACADRAFT_265128
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT SirB
Other DBs
NCBI-GeneID: 18919020
NCBI-ProteinID: XP_007401661
JGI: Phaca1_265128
UniProt: K5UJ53
Position
Unknown
AA seq 433 aa
MADTKNTDLNPRTKGYEFLGPPGTLFITLSVPATIYALYFGCSEHSGGCPPQLATIWPST
KISLQNPEFWKSLWDKDAAVMYLIWYIYCVVCWFVLPGDWIEGTTMRDGRRKKYKINAFT
TLLLTMGITIGWIMRFGPQSFTFIYEHWVGLVTASVSMSIFQGLYCYISSFFGDKLLALG
GNTGNPIYDFFIGRVLNPSIGSFDIKSFNELRPGLILWVLIDISMACEQAVRRGGKVTDS
LWLVLFFQALYVADGLYNEPAIFTTMDITTDGFGFMLSVGDLAWVPFVYSLQARYLVYKQ
IELGPVHTALILLVNLTGYWIFRGANGEKNDFRNGKNPRNLKTMDTKRGTKLLISGWWGM
CRHPNYFGDLLMALAWSLPTGFETPVTYFYVSYFLVLLMHRQYRDDENCEKKYGEDWHKY
KQLVSYRIVPYIY
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcggacacgaaaaacactgacctcaacccgcgcacgaagggctatgagttccttggt
ccgccgggcacgctcttcatcactctctctgtgccagcgacaatctatgcactctatttt
ggctgctccgagcactctggcggctgtccgccccaactggcgaccatctggcccagcaca
aaaatatcgttgcagaatcccgagttctggaagtctctgtgggataaggatgcggcagtc
atgtatcttatatggtacatttattgtgttgtttgctggttcgtcctcccaggggactgg
attgaagggacgacgatgcgggatggcaggaggaagaagtacaagatcaatgccttcact
acgctcttgttgaccatgggcattactattggctggatcatgcgcttcggaccccagtcc
ttcacgttcatctacgaacactgggttggtctcgtcactgcctccgtctcgatgtccatc
ttccaagggctgtactgttacatatcatcgttttttggcgacaagctcctcgcgctaggc
ggaaacacgggcaatccgatctacgatttcttcattggtcgggtgcttaacccctcgatt
ggctcattcgacatcaagtcattcaacgaactccgccccggcctaattctctgggttctc
attgacatcagcatggcgtgtgaacaggctgtccgtcgaggtggcaaggtcacagattca
ttgtggctggtcctctttttccaggccctctacgtcgcagatggcttgtataacgaaccg
gcgatcttcacaaccatggacatcactactgatggcttcggcttcatgctttccgtaggc
gacctcgcctgggtgcccttcgtgtactctctgcaggcccgttacctcgtatataagcag
atcgagctgggacctgttcatacggcgctcatccttctcgttaatttgactggctactgg
atcttccgtggtgctaacggcgaaaagaacgacttccgcaatggcaagaaccccaggaac
ctcaagactatggatacgaagcgtggcacgaagctgctcatctctggatggtggggcatg
tgtcgccatcctaactactttggcgatctcttgatggctcttgcatggtctcttccgacc
gggtttgagactccggtcacatacttctatgtctcttatttcctggttctgttgatgcac
cgccaatatcgggacgacgagaactgcgagaagaaatacggcgaagactggcataaatat
aagcagctggtttcgtaccgcattgtcccctacatttactag

DBGET integrated database retrieval system