KEGG   Phanerochaete carnosa: PHACADRAFT_80382Help
Entry
PHACADRAFT_80382  CDS       T03128                                 

Definition
(RefSeq) glycoside hydrolase family 3 protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
pco  Phanerochaete carnosa
Pathway
pco00460  Cyanoamino acid metabolism
pco00500  Starch and sucrose metabolism
pco01100  Metabolic pathways
pco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHACADRAFT_80382
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PHACADRAFT_80382
Enzymes [BR:pco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PHACADRAFT_80382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 18920330
NCBI-ProteinID: XP_007403154
JGI: Phaca1_80382
UniProt: K5VP16
Position
Unknown
AA seq 483 aa AA seqDB search
YYQCLPGAATSSVLSSSSSTIASQSSSSSSGGGASSSSTSSAPPSQTSVANVSPEWATAY
QKAQAAVTKLSVTDMVNLGTGVQWQKGPCVGNTPAISSIPGFNGLCLQDSPVGVRYADGV
SVFPPEINVAATWNRTLMQQRGAAMGAEFKGKGVNVGLGPMMNLMRVPAAGRNWEGGGGD
PYLSGEVAFETITGIQSSGVQACAKHFIDNEQEHFRDSSSSNVDDRTEHELYGHPFLRSV
QANVAAVMCSYINGSFACENEQTLSGLLKGEYGFQGSYCCMETTKLWPTGLSDWWATHSG
APAVNAGLDMTMPGDESENSGTTYFGQNLVNAVNSGEVSQARIQDLATRVLAAWYLLGQD
QNYPAVNFNSWNSGEGQHVNVSGDHASLIRTIGAASQILLKNTNGALPLNKPKSIGIIGN
DAGSNPSGPNACTDRSCDVGILALGWGSGTANFPYLVAPVDAITARAAQDGTAVSSSLSD
TDL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
tactaccagtgtctacctggggccgccacctcgagcgttctgtcaagctccagcagcact
atcgccagtcaatccagcagtagttcgagcggcggtggagcaagttctagcagcacaagc
tcagctccgccgtcccagacatccgtagcgaacgtctccccggaatgggccaccgcctac
caaaaggctcaagcggccgttactaagctctcagtgacagacatggtcaacctcggtaca
ggcgtccaatggcagaaaggtccttgcgttggcaacactcctgctatctcgtctatacct
ggtttcaacggtctctgcctccaagacagccctgtgggggttcgttatgctgacggcgtc
tccgttttccctccggaaatcaacgttgctgccacgtggaaccgcacgctcatgcagcaa
cgcggagcagccatgggcgcagagttcaaggggaaaggagtaaacgtcggccttggcccc
atgatgaacctcatgcgtgtacccgctgctggtcgcaactgggaagggggaggcggtgat
ccttacctctccggcgaagtcgcatttgagactattactggcattcagtcatccggtgtg
caagcttgtgcgaaacattttatcgacaacgaacaagagcatttccgggattcgagctcg
tccaatgttgatgacaggacggaacacgaactttacggacatccgttcctccgcagcgtc
caagcgaacgtagcagctgtgatgtgcagctacatcaacggttcttttgcctgcgaaaac
gagcagactttgagcggactgctcaagggagagtacggcttccaaggctcgtattgttgt
atggaaactacaaaattatggccaaccggactatcagactggtgggctacgcactctggt
gcgcctgctgtcaacgcaggactcgatatgacgatgccaggagacgagtctgaaaattcc
gggacaacatactttggacagaaccttgtcaatgctgtaaacagcggcgaggtctcgcaa
gctaggatccaggacttggcgactcgtgtcctcgcagcatggtatcttttgggccaagat
cagaactaccccgcagtcaacttcaactcgtggaattccggcgagggccagcacgtcaat
gtctctggcgaccacgcgagcctcatccggactattggagccgcgtcccagatcctcctg
aagaacacgaacggggctctccccttgaacaagcccaagtctatcggcatcattggcaac
gacgcaggatccaaccccagtggtcccaatgcctgtaccgaccgctcatgtgacgtcgga
atccttgctctcggctggggcagcgggacggcgaatttcccatacctggtcgcccctgtt
gacgcgatcactgctcgtgcagcgcaagacgggactgctgtgtcgtcgtctctgagcgac
acagacctg

DBGET integrated database retrieval system