KEGG   Paracoccus contaminans: B0A89_09655Help
Entry
B0A89_09655       CDS       T04876                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcon  Paracoccus contaminans
Pathway
pcon00071  Fatty acid degradation
pcon00072  Synthesis and degradation of ketone bodies
pcon00280  Valine, leucine and isoleucine degradation
pcon00310  Lysine degradation
pcon00362  Benzoate degradation
pcon00380  Tryptophan metabolism
pcon00620  Pyruvate metabolism
pcon00630  Glyoxylate and dicarboxylate metabolism
pcon00640  Propanoate metabolism
pcon00650  Butanoate metabolism
pcon00900  Terpenoid backbone biosynthesis
pcon01100  Metabolic pathways
pcon01110  Biosynthesis of secondary metabolites
pcon01120  Microbial metabolism in diverse environments
pcon01130  Biosynthesis of antibiotics
pcon01200  Carbon metabolism
pcon01212  Fatty acid metabolism
pcon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0A89_09655
   00630 Glyoxylate and dicarboxylate metabolism
    B0A89_09655
   00640 Propanoate metabolism
    B0A89_09655
   00650 Butanoate metabolism
    B0A89_09655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B0A89_09655
   00072 Synthesis and degradation of ketone bodies
    B0A89_09655
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0A89_09655
   00310 Lysine degradation
    B0A89_09655
   00380 Tryptophan metabolism
    B0A89_09655
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0A89_09655
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0A89_09655
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0A89_09655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcon04147]
    B0A89_09655
Enzymes [BR:pcon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0A89_09655
Exosome [BR:pcon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0A89_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARJ69849
UniProt: A0A1W6CYH3
Position
complement(2043650..2044861)
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDAARTPRGKGRSDGSLHEVTALALSARLLNALKDRNGLDDHAVEDVIWGNVTQ
VMEQGGCLARSAVLASDLDQSIPGLSINRFCASGMEAVNLAASQVRAGAGAAYIAGGVEM
MSRVPMGSDGAAIAADPSLAMKSHFVPQGISADIIATEYGFTRQQADALAAESQRRAAEA
WAEGRFARSIVPVLDQNGLTILDRDEHMRPGTTAESLAALKPAFKDMGEVMPGFDKVAML
KYPHLGHIEHIHHAGNSSGIVDGAGAVLIGSREWGEARGLEPRARIRATAKIGTDPTIML
TGPVPVTEKILRESGLAIGDIDLFEVNEAFSAVVLRFMQAFDVSPQIVNVNGGAIAMGHP
LGATGAIIIGTLLDELERQDKQIGLATLCVASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcctatatctatgacgccgcccgcacgccgcgcggcaaggggcgcagtgac
ggcagcctgcacgaggtcaccgcgctggcgctgtccgcgcggctgctgaacgccctcaag
gaccgcaacgggctggacgaccatgcggtcgaggacgtgatctggggcaatgtcacgcag
gtcatggaacagggcggctgcctggcccgctcggcggtgctggcatccgatctcgaccag
tcgattccggggctgtcgatcaaccgcttttgcgccagcggcatggaggcggtgaacctt
gccgccagccaggtcagggccggcgcgggcgctgcctatatcgccggcggggtcgagatg
atgagccgcgttcccatgggcagcgacggcgccgccatcgctgccgatcccagcctggcc
atgaaaagccatttcgtcccgcagggcatcagcgccgacatcatcgccaccgaatacggc
tttacccgccagcaggccgacgcgctggccgccgaatcgcagcgccgtgccgccgaggcc
tgggccgaggggcgctttgcccgatccatcgtcccggtgctggaccagaacgggctgacg
atcctggaccgcgacgaacacatgcgccccggcaccaccgccgaaagccttgccgcgctc
aagcccgccttcaaggacatgggcgaggtgatgccgggcttcgacaaggtggcgatgctg
aaatacccgcatcttggccatatcgagcacatccaccacgccggaaactcgtcggggatc
gtggacggggccggggcggtgctgatcggcagccgcgaatggggcgaggcgcgcggcctt
gaaccgcgcgcccgcatccgcgccaccgccaagatcggcaccgatccgacgatcatgctg
accggcccggtcccggtgacggaaaagatcctgcgcgaaagcggcctcgcgatcggcgac
atcgacctgttcgaggtgaacgaggcgttctcggccgtcgtgctgcgcttcatgcaggcc
ttcgatgtctcgccgcagatcgtgaacgtcaatggcggcgccatcgccatgggccatccg
ctgggcgcgacgggcgccatcatcatcggcacgctgctggacgagctcgagcggcaggac
aagcagatcggccttgccacgctgtgcgtcgcatcgggcatgggcgcggcgacgatcatc
gagagggtgtga

DBGET integrated database retrieval system