KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_04195Help
Entry
JM49_04195        CDS       T03338                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00860  Porphyrin and chlorophyll metabolism
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
pcp01120  Microbial metabolism in diverse environments
Module
pcp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JM49_04195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcp01007]
    JM49_04195
Enzymes [BR:pcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     JM49_04195
Amino acid related enzymes [BR:pcp01007]
 Aminotransferase (transaminase)
  Class III
   JM49_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIS10903
Position
complement(902621..903904)
Genome map
AA seq 427 aa AA seqDB search
MSRSETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVTDEDDKRYVDYVGSWG
PMILGHSHPDVLDAVRKQLEHGLSYGAPTAMETEMADLVCSIVPSMEMVRMVSSGTEATM
SAIRLARGFTGRDSIIKFEGCYHGHSDSLLVKAGSGALTQGVPSSAGVPAAFAKHTLTLP
FNDIDAVEKMLAEVGQEVACIIVEPVAGNMNCVPPAPGFLEGLRSLCDKHGVVLIFDEVM
TGFRVALGGAQAHYGVTPDLSTFGKIIGGGMPVGCFGGKRQIMEHIAPLGPVYQAGTLSG
NPLAMAAGLTTLRLISRPGFHAELSDYTSRLLDGLQQRADAAGIPFVTTQAGGMFGLYFS
GADDIVTFDDVMASDANLFKRFFHLMLEGGVYLAPSAFEAGFTSIAHGDAELKLTLDAAE
RAFAALK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttccgaaaccctgtttgccaatgcccagaaacacatccccggtggcgtgaac
tcgcccgtgcgcgcgttcaagagcgtgggtggcacgccgctgttcttcaagcacgccgaa
ggcgcctacgtcaccgacgaagacgacaagcgctatgtggactacgtcggttcctggggc
ccgatgatcctcggccacagccatccggacgtgctggacgcggtacgcaaacagctggaa
cacggtctgtcctacggcgccccgaccgccatggaaaccgaaatggccgacctggtctgc
tccatcgtgccgtcgatggagatggtgcgcatggtcagctccggcaccgaagcgaccatg
agcgcgatccgcctggcccgtggtttcactggccgcgacagcatcatcaagttcgaaggc
tgctaccacggccactccgacagcctgctggtcaaggccggctccggcgcgctgacccag
ggcgtgcctagctcggccggcgtaccggcggccttcgccaaacacaccctgaccttgccg
ttcaacgacatcgacgcggtcgagaagatgctcgccgaagtcggccaggaagtggcctgc
atcatcgtcgagccggtggccggcaacatgaactgcgtgcctccggccccgggcttcctc
gaaggcttgcgcagcctgtgcgacaagcacggcgtggtgctgatcttcgacgaagtgatg
accggcttccgcgtcgccctcggcggcgcccaggcgcactacggcgttaccccggacctg
tcgaccttcggcaagatcatcggcggcggcatgccagtgggctgcttcggcggcaaacgc
cagatcatggaacacattgcgccgctgggcccggtctaccaggccggcaccctgtcgggc
aacccgctggccatggccgccggcctgaccaccctgcgcctgatcagccgcccgggcttc
cacgccgagctgagcgactacaccagccgcctgctcgacggcctgcagcaacgcgctgac
gccgccggcatcccgttcgtgaccacccaggcgggcggcatgttcggcctgtacttcagc
ggcgccgacgacatcgtcactttcgacgacgtgatggccagcgatgccaacctgttcaaa
cgcttcttccacctgatgctcgaaggcggtgtctacctggccccgagcgccttcgaagcc
ggcttcacctcgatcgcccacggcgacgccgagctgaagttgaccctggacgcggctgaa
cgcgctttcgccgccctgaagtaa

DBGET integrated database retrieval system