KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_04975Help
Entry
JM49_04975        CDS       T03338                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00071  Fatty acid degradation
pcp00072  Synthesis and degradation of ketone bodies
pcp00280  Valine, leucine and isoleucine degradation
pcp00310  Lysine degradation
pcp00362  Benzoate degradation
pcp00380  Tryptophan metabolism
pcp00620  Pyruvate metabolism
pcp00630  Glyoxylate and dicarboxylate metabolism
pcp00640  Propanoate metabolism
pcp00650  Butanoate metabolism
pcp00900  Terpenoid backbone biosynthesis
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
pcp01120  Microbial metabolism in diverse environments
pcp01130  Biosynthesis of antibiotics
pcp01200  Carbon metabolism
pcp01212  Fatty acid metabolism
pcp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JM49_04975
   00630 Glyoxylate and dicarboxylate metabolism
    JM49_04975
   00640 Propanoate metabolism
    JM49_04975
   00650 Butanoate metabolism
    JM49_04975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JM49_04975
   00072 Synthesis and degradation of ketone bodies
    JM49_04975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JM49_04975
   00310 Lysine degradation
    JM49_04975
   00380 Tryptophan metabolism
    JM49_04975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JM49_04975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JM49_04975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JM49_04975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcp04147]
    JM49_04975
Enzymes [BR:pcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JM49_04975
Exosome [BR:pcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JM49_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS11052
Position
complement(1076878..1078056)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLANISAVDLGAAVIRQLLAQTGLDGAQVDEVIMGQVLTAG
AGQNPARQAAIKAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGQENMSL
ANYVLPGARTGLRMGHSQIVDSMISDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKAVAAIEGGRFVDEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDG
TVTAGNASSLNNGAAAVILMSAAKAKALGLPVLAKIAAYANAGVDPAIMGIGPVSATRRC
LDKAGWSLEQLDLIEANEAFAAQSLSVGKELGWDASKVNVNGGAIALGHPIGASGCRVLV
TLLHEMLKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtaatcgttgccgccacccgcaccgcggtcggcagtttccagggttcg
ctggcgaacatttccgcggtcgatctcggcgccgcggtgatccgccagctgctggcccag
accggcctggatggcgcccaggtcgatgaagtgatcatgggccaggtgctcaccgccggc
gccgggcagaaccccgcgcgccaggccgcgatcaaggccggcctgccccacgccgtgccg
gcgctgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcatcgccggcggccaggagaacatgagcctg
gccaactacgtgctgcccggcgcccgcaccggcctgcgcatgggccatagccagatcgtc
gacagcatgatcagcgacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaaatacggcatcagccgcgaagcccaggacgcctttgccgcc
gcctcgcagcagaaggccgtggccgccatcgaaggcgggcgttttgtcgatgagatcacc
ccgatcctgattccccagcgcaagggcgatccggtggccttcgccaccgacgaacaaccg
cgcgccggcaccaccgccgaatccctgggcaagctcaaaccggccttcaagaaggacggc
acagtcaccgccggcaacgcctcgtcgctgaacaacggcgccgccgcggtgatcctgatg
agcgccgccaaggccaaggccctgggcctgccggtgctggcgaagatcgccgcctacgcc
aacgccggcgtcgacccggcgatcatgggcatcggcccggtgtcggccacccgtcgctgc
ctggacaaggccggctggtccctggagcaactggacctgatcgaagccaacgaagccttc
gccgcgcaatcgctgtcggtgggcaaggaactggggtgggacgcgagcaaggtcaacgtc
aacggcggcgccatcgccctcggccacccgatcggcgcctcgggctgccgggtgctggtg
accctgctgcacgaaatgctcaagcgcgatgccaagaaaggcctggcgaccttgtgcatc
ggtggcggccagggcgtggcattggcgatcgaacgctaa

DBGET integrated database retrieval system