KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_05670Help
Entry
JM49_05670        CDS       T03338                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00020  Citrate cycle (TCA cycle)
pcp00620  Pyruvate metabolism
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
pcp01120  Microbial metabolism in diverse environments
pcp01130  Biosynthesis of antibiotics
pcp01200  Carbon metabolism
Module
pcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JM49_05670
   00620 Pyruvate metabolism
    JM49_05670
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     JM49_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIS11181
Position
complement(1215309..1216820)
Genome map
AA seq 503 aa AA seqDB search
MAHNEAVDVVLVGAGIMSATLAVLLKELDPAIKLEVVELMDSGAAESSNPWNNAGTGHAG
LCELNYTPQAADGSIDIKKAVHINTQFEVSKQFWSYLTKKGTFGSSKSFISPVPHLSFVQ
GESGVSFLKKRYEVLSKHHAFADMEYTEDKAKMAEWMPLMMPGRPADEVIAATRVINGTD
VNFGALTNQLLKHLTSAPDAQVKYCKRVTGLKRNKDNGWTVSIKDVNSGNSRDVDAKFVF
LGAGGAALPLLQASGIEESKGFGGFPVSGQWLRCDNPEVVKRHQAKVYSQAAVGSPPMSV
PHLDTRVVDGKKSLLFGPYAGFTTKFLKHGSFMDLPMSVRAGNIGPMLAVARDNMDLTKY
LVSEVMQSMEQRLESLRRFYPEAKAEDWRLEVAGQRVQIIKKDPKKGGVLQFGTELVAAK
DGSLAALLGASPGASVTVSIMLELIERCFPAKATGEWASKLKEIFPAREKALETDAALYR
KINSENNVSLELVEQSSEAESYA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacgaagcagtagacgtcgtattggttggggccggcatcatgagtgccacc
ctcgctgtactgctcaaagaactcgaccccgcgatcaagctggaagtcgtcgagctgatg
gattcgggtgccgcggaaagttccaacccgtggaacaacgccggtaccggccatgccggc
ctttgtgagctgaactacacgccacaggccgccgacggttccatcgatatcaagaaagcc
gtgcacatcaacacccagttcgaggtgtcgaagcagttctggtcctacctgaccaagaaa
ggcaccttcggctcgtccaagtcctttatcagcccggtgccgcacctgagtttcgtccag
ggcgagagcggcgtgtccttcctgaagaagcgctatgaagtgctgagcaagcaccacgct
ttcgcggacatggaatacaccgaggacaaggccaagatggccgagtggatgccgctgatg
atgccaggtcgcccggcagacgaagtcatcgccgccacccgcgtgatcaatggcaccgac
gtcaacttcggcgccctgaccaaccagttgctcaagcacctgaccagcgcacccgatgcc
caggtcaagtactgcaagcgcgtgaccggtctgaaacgcaacaaggacaacggctggacc
gtgagcatcaaggacgtcaacagcggcaacagccgcgacgtcgatgccaagttcgtgttc
ctcggcgctggcggcgcggcgctgccgctgctgcaggcttcgggcatcgaagagagcaaa
ggcttcggcggcttcccggtcagcggccagtggctgcgttgcgacaacccggaagtggtc
aagcggcaccaggccaaggtctacagccaggcggccgtgggttcgccacccatgtccgtg
ccgcacctggacacccgtgtggtcgatggcaagaagtccctgctgttcggaccttacgcc
ggcttcaccaccaagttcctcaagcacggttctttcatggacctgccgatgtcggttcgc
gccggcaacatcggcccgatgctggcagtggctcgcgacaacatggacctgaccaagtac
ctggtcagcgaagtgatgcagtccatggagcagcgcctggaatccctgcgtcgcttctac
cctgaagccaaagccgaagactggcgcctggaagtggccggccagcgggtgcagatcatc
aagaaagatccgaagaaaggcggcgtgctgcagttcggcaccgagctggtcgcagccaag
gacggctctctcgccgccctgcttggcgcttcgccaggcgcttcggtgaccgtctcgatc
atgctcgaactgatcgagcgctgcttcccggccaaggcgaccggtgagtgggccagcaag
ctcaaggaaatcttcccggcccgtgaaaaagccctggaaaccgacgccgcgctgtaccgc
aagatcaacagcgagaacaacgtcagcctggagctggtcgagcagagcagcgaagccgaa
agctacgcttaa

DBGET integrated database retrieval system