KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_07700Help
Entry
JM49_07700        CDS       T03338                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00260  Glycine, serine and threonine metabolism
pcp00630  Glyoxylate and dicarboxylate metabolism
pcp00670  One carbon pool by folate
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
pcp01130  Biosynthesis of antibiotics
pcp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JM49_07700 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JM49_07700 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    JM49_07700 (gcvT)
Enzymes [BR:pcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     JM49_07700 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AIS11569
UniProt: A0A3G7K579
Position
complement(1647403..1648527)
Genome map
AA seq 374 aa AA seqDB search
MSTETLLKTPLHSLHLELGARMVPFAGYDMPVQYPLGVMKEHQHTREQAGLFDVSHMGQI
RLSGANAAQALETLVPVDIIDLPVGMQRYAMFTNENGGILDDLMVANLGNDELFLVVNAA
CKEQDLAHLRQHIGQACSIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKL
LGVDCFVSRSGYTGEDGFEISVPAADAETLARALLAEPEVAAIGLGARDSLRLEAGLCLY
GHDMNSQTTPIEASLLWAISKPRRADGARAGGFPGAEQVFAQQLNGVQRKRVGLLPQERT
PVREGAEIVNEAGEVIGSVCSGGFGPTLGGPLAMGYIDSAYVALDTPVWAIVRGKKVPML
VSKMPFVAQRYYRG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaaacactgttgaagaccccgctgcattcgctgcacctcgaactcggcgcg
cgcatggtgccgttcgccggttacgacatgcctgtgcaatacccgctgggcgtgatgaaa
gaacaccagcacacccgcgagcaggccggcctgttcgatgtctcgcacatgggccagatc
cgcctgagcggcgccaatgccgcccaggccctggaaaccctggtgccggtggacatcatc
gacctgcccgtgggcatgcagcgctatgccatgttcaccaatgaaaacggcggcatcctc
gacgacctgatggtcgccaacctgggcaacgacgaactgttcctggtggtcaacgccgcc
tgcaaggagcaggacctggcccatctgcgccagcacattggccaggcgtgcagcatcgag
ccgctgttcgaggagcgcgccctgctcgccctgcaaggccccgcggccgtcaccgtgctg
gcgcgcctggcgccggaagtggcgaagatgacattcatgcaattcgcccgcgtgaagctg
ctgggcgtggactgttttgtcagccgttcgggctacaccggcgaagacggtttcgaaatc
tcggtgccggcggccgacgccgaaaccctggcccgcgccctgctggccgaaccggaagtg
gcagcgatcggcctcggcgcccgtgactcgctgcgcctggaagccggcctgtgcctgtat
ggccatgacatgaacagccagaccaccccgatcgaagccagcctgctgtgggccatctcc
aagccacgtcgagccgatggtgcgcgggccggcggtttcccgggcgcggaacaggtgttc
gcccaacagctcaatggcgtgcagcgcaagcgcgtgggcctgctgccccaggaacgcaca
ccggtgcgtgaaggcgcggaaatcgtcaacgaagcgggcgaggtaatcggtagtgtttgc
agcggcggttttggtccgaccctgggcggtccgttggccatgggttacatcgatagcgct
tatgtcgcactcgatacgccagtttgggcaattgttcgtgggaaaaaggtgccaatgctt
gtaagcaaaatgccattcgttgcacaacgctactatcgcggttga

DBGET integrated database retrieval system