KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_19475Help
Entry
JM49_19475        CDS       T03338                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00450  Selenocompound metabolism
pcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    JM49_19475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcp03016]
    JM49_19475
Enzymes [BR:pcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     JM49_19475
Transfer RNA biogenesis [BR:pcp03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    JM49_19475
 Prokaryotic type
    JM49_19475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AIS13754
UniProt: A0A3G7ICU0
Position
complement(4268878..4269912)
Genome map
AA seq 344 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKISPQVLEVILAGSGAQNLDPKLWVGNASRDDAAVYAIDEER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLAPEVAREV
IRGGRAVCDAAGIPLAGGHSIDAPEPIFGLAVTGLVEKRHMKRNDTATAGCLLYLTKPLG
IGVLTTAEKKGKLRSADVGLARDWMCTLNKPGSRFGKLDGVTAMTDVTGFGLLGHLVEMA
DGSNLTARIHYDRVPRLPGVEYYLDQGCIPGGTQRNFDSYANKLGRIQALHKLVLCDPQT
SGGLLIAVTPEGNAAFLALAAELGLELAPIGELVERQSNAVEVI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgattcgcctgacccagtacagccacggcgcgggttgcggttgcaagatt
tctccccaggtcctggaggtgattctggccggcagcggcgcgcagaacctcgacccgaaa
ctctgggtcggcaacgcctcgcgcgacgacgcggcggtgtacgccatcgacgaagagcgc
ggcgtggtctcgaccaccgactttttcatgccgatcgtcgacgacccgttcgacttcggc
cgcatcgccgccaccaacgccatcagcgacatctacgccatgggcggcgacccgttgatg
gccatcgccattcttggctggccggtgaatgtgctggccccggaagtcgcccgcgaggtg
attcgcggcggccgcgcggtgtgcgacgcggccggcattcccctggccggcggccattcg
atcgacgcgccggaaccgatctttggcctggccgtcaccggcctggtggaaaagcgccac
atgaagcgcaacgacaccgccaccgccggttgcctgttgtacctgaccaaacccctgggc
atcggcgtgctgaccaccgccgagaagaagggcaagctgcgcagcgccgacgtcggcctg
gcccgtgactggatgtgcaccctgaacaagcccggtagccgtttcggcaagcttgatggc
gtgaccgcgatgaccgacgtcaccggtttcggcctgctcgggcacctggtggaaatggcc
gacggcagcaacctgaccgcgcgcattcactacgaccgcgtgccgcgcctgcctggggtc
gagtactacctggaccagggctgcataccgggcggcacccagcgcaatttcgacagctac
gccaacaagctcgggcgtatccaggccctgcacaagctggtgctgtgcgacccgcagacc
agcggcgggctgttgattgccgtcaccccagaaggcaatgcggccttcctcgcgctggcc
gccgaactcggcctggaactggcgccgatcggtgagctggtggaacgacagagcaacgcg
gtcgaggtgatctga

DBGET integrated database retrieval system