KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_23275Help
Entry
JM49_23275        CDS       T03338                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00040  Pentose and glucuronate interconversions
pcp00053  Ascorbate and aldarate metabolism
pcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JM49_23275
   00053 Ascorbate and aldarate metabolism
    JM49_23275
Enzymes [BR:pcp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     JM49_23275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIS14471
Position
complement(5109737..5111311)
Genome map
AA seq 524 aa AA seqDB search
MPVTGQLLIGQARVRGGHGEVHALAAATGEALAPSFGGAGPNDLERACALAEAAFDRYRE
TSLEQRAAFLESIASNILALGDELIERCMSETGLPRARLEGERGRTVGQLRLFAAVVRDG
SFLEARIDPAQPQRQPLPKVDLRLRQIAIGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKAHSAHPGTSELVGQAIQQAVHSHGLPEGVFSLLFDAGRSIGQGLVADSRIKAVGFT
GSRSGGVALMQIAAAREEPIPVYAEMSSINPVLLLTNALAERGEEIAKAFVGSLILGAGQ
FCTNPGLILAVDSPALRAFEAAAAAGLKVAPAQTMLTPGIHASYCQGVERLLRHAEVDCL
GQGGEGERYQARAALFATSAAAFMARAELREEIFGPASLLVRCTDAAQMKALLATLEGQL
TIALHLSDDDHPQARELLPLLERKAGRLLVNGFGTGVEVGHAMVHGGPFPATSDTRTTSV
GSLAIQRFLRPVSYQDLPQALLPQALRSDNPWQVPQRLNGERPR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaacaggacaactgctgatcggccaagcccgtgtgcgtggcggccacggcgaa
gtgcatgcgctggccgccgccaccggcgaagcgctggcgccgagttttggcggcgccggc
ccgaatgacctggagcgcgcctgcgccctggccgaggcggcattcgaccgctatcgggaa
accagcctggaacaacgggcggcctttctcgagagcatcgccagcaacatcctcgccctc
ggcgacgagctgatcgagcgctgcatgagcgagaccggcctgcctcgcgcccgcctggaa
ggcgagcgcgggcgcacggtcggccaactgcgtttgttcgcggcggtggtgcgcgacggc
agtttcctggaggcgcgcatcgacccggcccagccgcagcgccagcccttgcccaaggtg
gatctgcgcctgcgccagatcgctattgggccggtggcggtattcggtgcctcgaacttt
cccctggcgttttccgtggccggcggcgacaccgcctcagcgctggccgccggttgcccg
gtggtggtcaaggcgcattcggcgcaccccggtacttcggaactggtggggcaggcgatc
cagcaggcggtgcatagccacggcttgccggaaggggtgttctcactgctattcgatgcc
ggccgcagcattggccaagggttggtggcggacagtcggatcaaggctgtgggctttacc
ggttcgcgcagcggcggggtggcgctgatgcagatcgccgcggcccgcgaggagccgatc
ccggtctatgccgagatgagttcgatcaacccggtgctgctgttgaccaatgcactggcc
gagcggggtgaagaaattgccaaggcctttgtcggttccctgatcctgggtgccggccag
ttctgcaccaacccggggttgatcctcgccgtcgacagcccggcgctacgggcatttgaa
gccgcggcggccgcagggctcaaggtggcgccggcgcagaccatgctgacgccgggcatc
cacgccagctactgccagggtgtcgagcggctgctgcggcatgccgaggtggactgcctg
gggcagggcggcgagggcgagcgttatcaggcccgggccgcgttgttcgccacgtcggcg
gcggcctttatggccagggcggagttgcgggaagaaatcttcggcccggcctcgttgctc
gtgcgctgcaccgatgcggcccagatgaaagcactgctggcgaccctggaaggtcagctg
accatcgccctgcacctgagcgacgacgaccatccgcaagcccgggaactgctgccgttg
ctggagcgaaaggccggccgcctgctggtcaacggttttggcaccggtgtcgaagttggc
catgccatggtccacggcggtccgttcccggccacctcggacacgcgcaccacctcggtg
ggcagcctggcgatccagcgtttcctgcgcccggtgtcctatcaggacttgccgcaagca
ctgctgccgcaggccctgcgcagcgacaacccctggcaggttccgcagcgtctcaacggt
gagcggccgcgttga

DBGET integrated database retrieval system