KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_23370Help
Entry
JM49_23370        CDS       T03338                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00051  Fructose and mannose metabolism
pcp01100  Metabolic pathways
pcp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    JM49_23370
Enzymes [BR:pcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     JM49_23370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIS14490
UniProt: A0A1E1FS92
Position
5127961..5128743
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKEQLVKQALTQMQNTLADNTWTDRQKLALTCRILFENGHDSGLAGQITARGP
QPGTYYTQQLGLGFDEITAGNLLLVNEDLEVLEGHGMPNPANRFHSWVYRARPDVNCIIH
THPTHVAALSMIEVPLEISHMDLCPLYDDCAFLKAWPGVPVGNEEGEIISAALGDKRAIL
LSHHGQLSTGASIEEACVIAQLIERAAKLQLLAMAAGTIKPILPELGREAHDWISKPKRH
AAAFNYYARQNLKQHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcactacccaaagagcaactggtcaagcaagccttgacccagatg
caaaacaccctggcggataatacgtggaccgaccggcaaaagctggcgctgacgtgccgc
atcctgttcgagaacgggcacgactccggcctggccgggcagatcaccgcccgcggcccg
cagccgggcacttactacacccagcaactgggcctgggcttcgacgaaatcaccgcgggc
aacctgctgctggtcaacgaagacctggaggtgctcgaaggccacggcatgcccaacccg
gccaaccgtttccacagctgggtgtaccgcgcccgccccgacgtgaactgcatcatccac
acgcacccgacccacgtcgccgcgttgtcgatgatcgaagtgccgctggaaatctcccac
atggacctgtgcccgctgtacgacgactgcgcctttctcaaagcctggccgggcgtgccg
gtgggtaacgaagaaggcgagatcatctccgcggccctgggcgacaagcgcgccatcctg
ctctcgcaccacggccagctgtccaccggcgccagcatcgaggaagcctgtgtgatcgcc
cagctgatcgagcgcgccgccaagctgcaattgctggccatggccgccggcaccatcaag
ccgatcctgccggagctcggtcgcgaggcccatgactggatctccaagcccaagcgccac
gccgccgccttcaactactacgctcggcaaaacctcaagcaacacgccgattgcctgaac
tga

DBGET integrated database retrieval system