KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_27620Help
Entry
JM49_27620        CDS       T03338                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00564  Glycerophospholipid metabolism
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
Module
pcp_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    JM49_27620
Enzymes [BR:pcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     JM49_27620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIS15308
Position
6040749..6041609
Genome map
AA seq 286 aa AA seqDB search
MKKRLFILSQYLLPHHLMSRLAGCIAECRVRWFKNAFTAWFAKRYQVDMSQALVEDLTAY
EHFNAFFTRALKDGARPLDQTPGAILSPADGAVSQLGPIEHGRVFQAKGHSFSVLELLGG
DSALAAPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYVPGRIFSVNQTTAENVPELFA
RNERVVCIFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKTVRYDEAARAPIHLE
KGAELGRFKLGSTAIVLFGPEQVQWAEELAAGSPVQMGQGIGLAKA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgtttgtttatcctcagccagtacctgctgcctcaccacctgatgtcgcgc
ctggccggctgcattgccgagtgccgcgtgcgctggttcaagaatgccttcaccgcctgg
ttcgccaagcgctatcaggtggacatgtcgcaagcactggtggaagacctgaccgcctac
gagcacttcaacgccttcttcacccgcgccctgaaagacggcgcccgcccgctggaccag
acgccgggcgcgatcctcagcccggccgacggcgcggtcagccagctcggcccgatcgaa
cacggccgggtattccaggccaagggccacagcttcagcgtgctggaactgctgggtggc
gattcggccctggcggctccgttcatgggcggcgacttcgccaccatctacctgtcgccg
aaggactaccatcgcgtgcacatgccgctggccggcaccctgcgggaaatggtctacgtg
ccagggcggatcttctcggtcaaccagaccaccgcggaaaacgtgccagagctgttcgcc
cgcaacgagcgcgtggtgtgcattttcgataccgagcgcggcccgatggccgtggtactg
gtgggcgcgatgatcgtggcctcgatcgaaactgtctgggccggcctggtgactccgccg
aagcgcgaactgaagaccgtgcgctacgacgaagccgcccgcgcgccgatccacctggaa
aaaggcgccgaattgggccgcttcaagctgggctccaccgcgatcgtgctgttcgggccg
gagcaagtgcagtgggccgaagaactggcggccggctcgccggtgcagatgggccagggc
atcggcctggccaaggcctga

DBGET integrated database retrieval system