KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_29985Help
Entry
JM49_29985        CDS       T03338                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00020  Citrate cycle (TCA cycle)
pcp00620  Pyruvate metabolism
pcp00650  Butanoate metabolism
pcp01100  Metabolic pathways
pcp01110  Biosynthesis of secondary metabolites
pcp01120  Microbial metabolism in diverse environments
pcp01130  Biosynthesis of antibiotics
pcp01200  Carbon metabolism
Module
pcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JM49_29985
   00620 Pyruvate metabolism
    JM49_29985
   00650 Butanoate metabolism
    JM49_29985
Enzymes [BR:pcp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     JM49_29985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AIS15762
Position
6588081..6589574
Genome map
AA seq 497 aa AA seqDB search
MYRDRIRLPSLLDKVMSAADAAALIQDGMTVGMSGFTRAGEAKAVPHALAERAKVTPLKI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINAGEVMFIDQHLSETVEQLRNQ
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKHVIVEINLAHNPNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSTAIPIPAEKIVAIVITNQADSPSTVSTPDSETQGIANHL
INFFKQEVDAGRMSNKLGPLQAGIGNIANAVMCGLIESPFEDLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSSRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEVGLADLRGLAPRERARVIIDNCVHPDYRQPLNDYFTAACALGGHTPHILRD
ALRWHMNLEETGRMLAV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgtatccgcttgccttcgttgttggataaggtgatgagcgccgccgac
gctgccgctctgattcaggacggcatgaccgtcggcatgagcggcttcacccgcgccggc
gaagccaaggccgtgccccatgcgttggccgagcgcgccaaggtaaccccactgaaaatc
agcctgatgaccggcgccagcctgggcaacgacctcgacaagcaattgaccgaggccggt
gtcctggcccgacgcatgccgttccaggtcgacagcaccctgcgcaaggcgatcaatgcc
ggcgaggtgatgttcatcgaccagcacctgtcggaaaccgtggaacagctgcgcaaccag
cagctcaagctgccggacatcgccgtcatcgaagccgtggcgatcaccgagcagggccat
atcgtgccgaccacctcggtgggcaactccgccagtttcgcgattttcgccaagcacgtg
atcgtcgagatcaacctggcgcacaacccgaacctggaaggcctgcacgacatctatatc
ccgacctaccggccgacccgcacgcccatcccgctggtgaaggtcgacgaccgtatcggc
agcaccgccatcccgattccggcggagaagatcgtcgccatcgtcatcaccaaccaggcg
gactcgccatccaccgtttcgacgccagacagcgaaacccaggggatcgccaaccacctg
atcaacttcttcaagcaggaagtggacgctgggcgcatgagcaacaagcttggcccgctg
caggcaggtatcggcaatatcgccaacgcggtgatgtgcggcctgatcgaatcgccgttc
gaagacctgaccatgtactccgaagtgctgcaggactcgactttcgacctgatcgacgcc
ggcaagctgagcttcgcttcgggcagctcgatcaccctgtcgagccgtcgcaacgccgat
gtgttcggcaatctggagcgctacaaggacaagctggtgctgcgcccgcaggagatctcc
aaccatccggaagtggtgcgtcgcctgggcatcatcggcatcaacaccgccctggagttc
gacatctacggcaacgtcaattccacccacgtctgcggcacgcggatgatgaacggcatc
ggcggttcgggtgacttcgctcgcaacgcgcacctggcgatcttcgtcaccaagtccatt
gccaagggcggggcgatttccagcgtggtgccgatggtcagccacgtcgaccacaccgaa
catgacgtcgacatcctggtgaccgaagtcggcctggccgacctgcgtggcctggcgcca
cgggagcgggcccgggtgatcatcgacaactgtgtacacccggactatcgccagcccctg
aatgactacttcaccgccgcctgcgccctgggcggccacacgccgcacatcctgcgcgat
gccctgcgctggcacatgaacctggaagaaaccgggcgcatgctcgctgtgtga

DBGET integrated database retrieval system