KEGG   Pseudomonas chlororaphis subsp. aurantiaca: JM49_30485Help
Entry
JM49_30485        CDS       T03338                                 

Definition
(GenBank) glycine-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pcp  Pseudomonas chlororaphis subsp. aurantiaca
Pathway
pcp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pcp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JM49_30485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcp01007]
    JM49_30485
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcp03016]
    JM49_30485
Enzymes [BR:pcp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     JM49_30485
Amino acid related enzymes [BR:pcp01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   JM49_30485
Transfer RNA biogenesis [BR:pcp03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    JM49_30485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AIS15861
UniProt: A0A1E1G6G9
Position
6686382..6688436
Genome map
AA seq 684 aa AA seqDB search
MSAQDFLVELGTEELPPKALNTLAEAFLGGIEKGLQAAGLNFETKHVYAAPRRLAVLISG
LATQQPDRSINLDGPPRQAAFDAEGNPTQAALGFAKKCGVDLSEIDQSGPKLRYSQSIKG
KPTASLLPTIVEDSLNDLPIPKRMRWAARKEEFVRPTQWLVMLLGDQVIDCTILAQKAGR
DSRGHRFHHPQSVRITSPANYLDDLRAAYVLADANERRELISKRTEELARLQEGTAIVPA
DLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQKYFCLLDVDGKLLPRFITVA
NIESKDPRQIIEGNEKVVRPRLTDAEFFFKQDKKQKLEDFNQRLQNVVFQEKLGSVYDKA
ERVSKLAAFIAPRIGGDAQRAARAGLLSKCDLATEMVGEFPEMQGIAGYYYALNDGEPED
VALALNEQYMPRGAGAELPSTVTGAAVAIADKLDTLVGIFGIGMLPTGSKDPYALRRAAL
GVLRILIDKKLDLDLTEAVAFAVSAFGSKVKSAGLADQVLEFIFDRLRARYEDEGVDVAT
YLSVRALKPGSALDFDQRVQAVQAFRKLPEAAALAAVNKRVSNLLSKVEGSVPTTVEAKY
FDNANEFSLYSAIQQADQAVQPMAAARQYSETLARLAALREPVDAFFEKVMVNAEDANVR
ANRYALLARLRGLFLGVADISLLG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcaagattttctggttgaactgggcactgaagaactgccacccaaagcactg
aacaccctggccgaagccttcctgggcggtatcgaaaaaggcctgcaggccgccggcctg
aacttcgagaccaaacacgtctacgccgcaccacgccgcctggcagtgctgatcagcggc
ctggccacccagcagccggatcgcagcatcaacctcgacggcccgccgcgtcaggccgcc
ttcgacgccgaaggcaacccgacccaggctgcactgggcttcgccaagaaatgtggcgtg
gacctgagcgaaatcgaccagagcggaccgaagctgcgctacagccagagcatcaagggc
aagccgaccgccagcctgctgccgaccatcgtcgaagactcgctgaacgacctgccgatt
ccaaaacgcatgcgttgggccgcgcgcaaggaagagttcgtgcgtccgacccaatggctg
gtgatgctgctcggtgaccaggtcatcgactgcaccatcctcgcccagaaagccggtcgc
gactcccgcggtcaccgcttccatcatccgcaaagcgtgcgcatcacctcgccggccaac
tacctggacgacctgcgtgccgcctacgtgctggccgacgccaacgagcgtcgcgaactg
atcagcaagcgcaccgaagaactggcgcgcctgcaggaaggtactgccatcgttccagcc
gatctgctggacgaagtgaccgccctggtggaatggccggtaccgctggtgtgctcgttc
gaggagcgtttcctcgaagtgccgcaggaagccctgatcaccaccatgcaggacaaccag
aaatacttctgcctgctggacgtcgacggcaagctgctgccgcgcttcatcaccgtggcc
aacatcgaaagcaaggacccgcgccagatcatcgagggcaacgagaaagtcgttcgccca
cgcctgaccgacgccgagttcttcttcaagcaggacaagaaacagaagctcgaagacttc
aaccagcgcctgcagaacgtggtgttccaggagaagctgggcagcgtctacgacaaggcc
gagcgcgtctcgaaactggccgcgttcatcgccccgcgcatcggtggcgacgcccagcgt
gctgcgcgtgcgggcctgctgtcgaagtgcgacctggccaccgaaatggtcggcgagttc
ccggaaatgcaaggcatcgccggttactactacgcgctcaatgacggcgagccggaagac
gtcgccctggcgctgaacgagcagtacatgccgcgcggcgccggcgccgagctgccaagt
accgtcaccggtgctgccgtggccatcgccgacaagctcgacaccctggtcggcatcttc
ggcatcggcatgctgccaaccggcagcaaggacccgtacgcactgcgtcgggccgcgctg
ggcgtgctgcgcatcctgatcgacaagaagctcgacctggacctgaccgaagccgtggcg
ttcgccgtcagcgcgttcggcagcaaggtcaagagcgctggcctggccgatcaggtcctg
gagttcatcttcgaccgtctgcgtgcccgttacgaagacgaaggcgtggatgtcgccacc
tacctgtcggtccgtgccctgaagccgggttcggccctggacttcgaccagcgcgtgcaa
gccgtgcaggccttccgcaagctgccggaagccgctgcgctggccgcggtgaacaagcgc
gtctcgaacctgctgagcaaggtcgaaggcagcgtgccgaccaccgtggaagccaagtac
ttcgacaacgccaacgagttctccctgtactcggcgatccagcaagcggaccaggccgtg
cagccaatggccgcggcgcgtcagtacagtgagaccctggcccgcctggccgccctgcgc
gagccggtcgacgccttcttcgagaaggtcatggtcaacgccgaagacgccaacgtgcgg
gccaaccgctacgcgctgctggcacgtctgcggggtctgttcctcggtgtcgccgacatc
tcgttgctggggtaa

DBGET integrated database retrieval system