KEGG   Pseudomonas citronellolis: PcP3B5_01310Help
Entry
PcP3B5_01310      CDS       T04637                                 

Gene name
fdhA_1
Definition
(GenBank) Glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00625  Chloroalkane and chloroalkene degradation
pcq00680  Methane metabolism
pcq01100  Metabolic pathways
pcq01120  Microbial metabolism in diverse environments
pcq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PcP3B5_01310 (fdhA_1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PcP3B5_01310 (fdhA_1)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PcP3B5_01310 (fdhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMO73645
UniProt: A0A127MKH7
Position
complement(143675..144874)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGKQIDHGVILRVVSTNICGSDQHMVRGRTTA
PTGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLLKLPDREKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSSVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPTRLAHAKAQGFEIADLSKD
TPLHEQIADLLGEPEVDCAVDAVGFEARGHGHSGSQHEAPATVLNSLMGITRVAGQIGIP
GLYVTEDPGAVDDAAKHGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVITLDEAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtttatctcggcccaggtaaggtcgaggttcagaacatc
ccctatcccaagatgcaggacccgcaaggcaagcagatcgaccacggggtgatcctgcgg
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgcaccaccgcg
cccaccggcctggtgctgggccacgagatcaccggcgaggtggtggagatcggccgcggc
gtggaaaccatgaagatcggcgacctggtctcggtgcccttcaacgtcgcctgcggccac
tgccgcacctgcaaggaacagcacaccggcgtctgcctgacggtcaacccggcccgcgcc
ggcggcgcctacggctacgtcgacatgggcggctgggtcggcggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctgaagctgccggaccgcgagaaggccatggag
aaaatccgcgacctgacctgcctgtccgacatcctgcccaccggctaccacggcgcggtc
accgccggcgtcggcccgggcagcagcgtgtacatcgccggcgcaggtcccgtcggcctg
gcggctgcggcttctgcccgcctgctgggcgccgcggtggtgatcatcggcgacgtcaac
ccgacccgcctggcccacgccaaggcccagggcttcgagatcgccgacctgtccaaggac
accccgctgcacgagcagatcgccgacctgctgggcgagccggaagtggactgcgcggtc
gacgcggtgggcttcgaggcccgcggccacggccattccggttcgcagcacgaggccccg
gccaccgtgctcaactcgctgatgggcatcacccgggtggccggccagatcggcatcccg
ggcctgtacgtcaccgaggacccgggcgcggtggacgacgccgccaagcacggcagcctg
agcatccgcttcggcctgggctgggccaagtcgcacagcttccacaccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccgcatcaagatcgcc
gacatcgtcggggtggaagtcatcaccctggacgaagcgcccaagggctacggcgagttc
gatgccggcgtgccgaagaaattcgtcatcgacccgcacaacctgttccgcgccgcctga

DBGET integrated database retrieval system