KEGG   Pseudomonas citronellolis: PcP3B5_01440Help
Entry
PcP3B5_01440      CDS       T04637                                 

Gene name
ltaE_1
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00260  Glycine, serine and threonine metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PcP3B5_01440 (ltaE_1)
Enzymes [BR:pcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PcP3B5_01440 (ltaE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMO73658
UniProt: A0A127MKK2
Position
160550..161599
Genome map
AA seq 349 aa AA seqDB search
MFDISQQFASDNYSGICPEAWAAMAEANRGHERAYGDDQWTARASDHFRELFETDCEVFF
AFNGTAANSLALAALCQSYHSVICAETAHVETDECGAPEFFSNGSKLLLARTDEQGKLTP
AAIREIALKRQDIHYPKPRVVTLTQATEVGTVYRPDELGALSATCRELGLHLHMDGARFS
NACAFLGATPAELTWKAGVEVLCFGGTKNGMAVGEAILFFDRELAEGFDYRCKQAGQLAS
KMRFLAAPWVGVLQDDAWLHYANHANQCARLLAQRVADVPGVQLMFPVEANGVFLQMSEP
ALEALRQRGWRFYTFIGAGGARFMCSWDTELERVEALAQDIRQVMGAVA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatttcccagcaattcgccagcgacaactattccggcatctgcccggaagcc
tgggccgccatggccgaggccaaccgcggccatgagcgggcctacggcgacgaccagtgg
acggcgcgcgcctccgaccacttccgcgagctgttcgagaccgattgcgaggtgttcttc
gccttcaacggcaccgccgccaactccctggccctggccgccctgtgccagagctaccac
agcgtgatctgcgccgagaccgcccacgtcgagaccgacgagtgcggcgccccggagttc
ttctccaacggctccaagctgctgctggcgcgtaccgacgagcagggcaagctgaccccc
gctgctattcgcgaaatcgccctgaagcgccaggacatccactatcccaagccacgggta
gtgaccctcacccaggccaccgaggtcggtaccgtctaccgcccggacgaactgggcgcg
ctgagcgccacctgccgcgagctgggcctgcacctgcacatggacggcgcgcgcttctcc
aatgcctgcgccttcctcggcgccaccccggcggagctgacctggaaggccggcgtcgag
gtgctgtgcttcggcggcaccaagaacggcatggcggtgggcgaggccatcctgttcttc
gaccgcgaactggccgaaggcttcgactaccgctgcaagcaggccggccagctggcctcg
aagatgcgcttcctcgccgcgccctgggtcggcgtgctgcaggacgacgcctggctgcac
tacgccaaccacgccaaccagtgcgcgcgcctgctggcgcagcgggtggccgacgtgccg
ggcgtgcagctgatgttcccggtggaggccaacggggtgttcctgcagatgtccgagccg
gccctggaagccctgcgccagcgcggctggcgcttctacaccttcatcggcgccggcggc
gcgcgcttcatgtgctcctgggacaccgagctggagcgtgtcgaggccctggcgcaggac
attcgccaggtaatgggcgccgtcgcctga

DBGET integrated database retrieval system