KEGG   Pseudomonas citronellolis: PcP3B5_02710Help
Entry
PcP3B5_02710      CDS       T04637                                 

Gene name
zwf_1
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00030  Pentose phosphate pathway
pcq00480  Glutathione metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
Module
pcq_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PcP3B5_02710 (zwf_1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PcP3B5_02710 (zwf_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcq04147]
    PcP3B5_02710 (zwf_1)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PcP3B5_02710 (zwf_1)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PcP3B5_02710 (zwf_1)
Exosome [BR:pcq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PcP3B5_02710 (zwf_1)
  Exosomal proteins of colorectal cancer cells
   PcP3B5_02710 (zwf_1)
  Exosomal proteins of bladder cancer cells
   PcP3B5_02710 (zwf_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AMO73784
UniProt: A0A127MKF1
Position
complement(304031..305503)
Genome map
AA seq 490 aa AA seqDB search
MMSETSAFPLSCDILVFGGTGDLALHKLLPALYHLHREERLPADTRILALARSQRSQEAY
LALAERHCRAQVARADFSVADWQSFATRLDYLAMDASQSADFSRLRQRLKFGHERVLVHY
LATAPDLFAPIAQNLKVAGLAGPNTRIVLEKPLGHSLESARAINQAIGQVFDESRVFRID
HYLGKETVQNLLALRFANTLFEPLWRSAYVDHVQISVNETLGVENRGAYYDHAGAMRDMV
QNHLLQLLCLVAMEVPVHFDAESVRDEKLKILQALRPIGGLDVQDRTVRGQYGAGRIGGQ
EVPAYWFEKNVDNDSDTETFVALRAEIDNWRWAGVPFYLRTGKRMAKKCSEIVIQFKPVP
HALIGDGSGPANRLWIRLQPEERISLQLMTKTPGKGMRLEPAELDLNLAQTASPGKRRWD
AYERLLLDVIQGDSTLFMRRDEVEAAWRWIDPIIAGWQEHYQRPRPYPAGSNGPEQAQML
LELQGRRWLE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgaaacttccgcatttcccctttcctgcgacattctggtgttcggtggcacc
ggcgacctggcgctgcacaagctgctgccggcgctctaccacctgcaccgcgaggagcgc
ctgccggccgacacccgcatcctcgccctggcccgcagccagcgttcgcaggaggcctac
ctggcgctggccgagcggcactgccgggcgcaggtggcgcgggccgacttcagcgtcgcc
gactggcagagcttcgccacgcgcctggactacctggccatggacgcctcgcagagcgcc
gacttcagccgccttcgccagcgcctgaagttcggccatgagcgcgtgctggtgcactac
ctggccaccgccccggacctcttcgcgcccatcgcgcagaacctcaaggtcgccggcctg
gccgggccgaacacgcgcatcgtgctggagaagccgctgggccattcgctggaatcggcg
cgggcgatcaaccaggccatcggccaggtgttcgacgagtcgcgggtgttccgcatcgat
cactacctgggcaaggagacggtgcagaacctgctggccctgcgcttcgccaacaccctg
ttcgagccgctgtggcgcagcgcctacgtcgaccacgtgcagatcagcgtcaacgagacc
ctcggcgtggaaaaccgcggcgcctactacgaccacgccggggccatgcgcgacatggtg
cagaaccacctgctgcagctgctgtgcctggtggccatggaggtgccggtgcacttcgac
gccgagtcggtgcgcgacgagaagctgaagatcctccaggccctgcgcccgatcggcggc
ctcgacgtgcaggaccgcaccgtgcgcggccagtacggcgccgggcggatcggcggccag
gaggtaccggcctactggttcgagaagaacgtggacaacgacagcgacaccgagaccttc
gtcgccctgcgcgccgagatcgacaactggcgctgggccggcgtgcccttctacctgcgc
accggcaagcgcatggcgaagaagtgctcggagatcgtcatccagttcaagccggtgccc
cacgccctgatcggcgacggcagcggcccggccaaccgcctgtggataaggttgcagccg
gaggagcgcatcagcctgcagctgatgaccaagacccccggcaagggcatgcgcctggaa
ccggccgagctggacctgaacctggcgcagaccgccagccccggcaagcgccgctgggac
gcctacgagcgcctgctgctggacgtgatccagggcgactcgacgctgttcatgcgccgc
gacgaagtggaggccgcctggcgctggatcgacccgatcatcgccggctggcaggagcac
taccagcgcccgcgcccctaccccgccggcagcaatgggccggagcaggcgcagatgttg
ctggagttgcaggggcggcggtggttggagtga

DBGET integrated database retrieval system