KEGG   Pseudomonas citronellolis: PcP3B5_05600Help
Entry
PcP3B5_05600      CDS       T04637                                 

Gene name
bioA
Definition
(GenBank) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00780  Biotin metabolism
pcq01100  Metabolic pathways
Module
pcq_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PcP3B5_05600 (bioA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcq01007]
    PcP3B5_05600 (bioA)
Enzymes [BR:pcq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     PcP3B5_05600 (bioA)
Amino acid related enzymes [BR:pcq01007]
 Aminotransferase (transaminase)
  Class III
   PcP3B5_05600 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMO74068
UniProt: A0A127MLQ7
Position
complement(613609..615012)
Genome map
AA seq 467 aa AA seqDB search
MGLNAEWMQRDLEVLWHPCTQMKDHERLPVIPIRRGKGVWLEDFEGKRYLDAVSSWWVNV
FGHANPRINQRIKDQVDQLEHVILAGFTHAPVVELSERLVRLTPEGLSRVFYADNGSSGI
EVALKMSYHYWQNCGQPAKKRFVTLTNSYHGETVAAMSVGDVALFTETYKSLLLDTLKVP
SPDCYLRAEGESWEAHSRAMFEHMERTLEQHHREVAAVIVEPLIQGAGGMRMYHPVYLKL
LREACDRYGVHLIHDEIAVGFGRTGSMFACEQAGITPDFLVLSKALTGGYLPMAAVLTTD
TVYQAFYDDYATLRAFLHSHTYTGNPLACTAALATLDIFEQDNVIEANKALAARMASATA
HLADHPHVAEVRQTGMALAIEMVQDRTSRAAYPWQERRGLKVYQHALERGAMLRPLGNVV
YFLPPYVITPEEIDFLAEVASEGIDIACRDSVSVAVSGLYPDHRDPG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgaacgccgagtggatgcagcgcgacctggaggtgctctggcacccctgcacc
cagatgaaagaccacgagcgcctgccggtcatccccatccgccgcggcaagggcgtgtgg
ctggaggacttcgagggcaagcgctacctggacgcggtcagctcctggtgggtgaacgtc
ttcggccacgccaacccgcgcatcaaccagcgcatcaaggaccaggtcgaccagctggag
cacgtgatcctcgccggcttcacccatgcgcctgtggtcgagctgtccgagcgcctggtg
cgcctcacgcccgagggcctgtcgcgggtgttctacgccgacaacggctcctccggcatc
gaggtggcgctgaagatgagctaccactactggcagaactgcggccagccggcgaagaag
cgcttcgtcaccctgaccaacagctaccacggcgaaaccgtggcggcgatgtcggtgggc
gacgtggcgctgttcaccgaaacctacaagtcgctgctgctcgacaccctcaaggtgccc
agcccggactgctacctgcgcgccgagggcgagagctgggaagcccattcgcgggccatg
ttcgagcacatggagcgcaccctggaacagcatcaccgggaagtcgccgcggtcatcgtc
gaaccgctgatccagggcgccggcggcatgcgcatgtaccacccggtgtacctcaagctg
ctgcgcgaggcctgcgaccgctacggcgtgcacctgatccacgacgagatcgccgtcggc
ttcggccgcaccggcagcatgttcgcctgcgagcaggccggcatcaccccggacttcctg
gtgctgtccaaggcgttgaccggcggctatctgccgatggccgcggtgctgaccaccgac
accgtctaccaggccttctacgacgactacgccaccctgcgcgccttcctgcattcgcac
acctacaccggcaacccgctggcctgcaccgcggccctggcgaccctcgacatcttcgag
caggacaacgtgatcgaggccaacaaggccctggccgcgcgcatggcctcggccaccgcg
cacctggccgaccatccccacgtggccgaggtccgccagaccggcatggccctggccatc
gagatggtccaggacaggaccagccgcgcggcctacccctggcaggagcgccgcggcctg
aaggtctaccagcacgccctggaacgcggcgccatgctgcgcccgctgggcaacgtggtg
tacttcctgccgccctacgtgatcaccccggaggaaatcgacttcctcgccgaagtggcc
agcgaaggcatcgacatcgcctgccgggactcggtgagcgtggcggtcagcgggttgtac
ccggatcaccgggatccgggctag

DBGET integrated database retrieval system