KEGG   Pseudomonas citronellolis: PcP3B5_30090Help
Entry
PcP3B5_30090      CDS       T04637                                 

Gene name
sad
Definition
(GenBank) Succinate semialdehyde dehydrogenase [NAD(P)+] Sad
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00250  Alanine, aspartate and glutamate metabolism
pcq00650  Butanoate metabolism
pcq00760  Nicotinate and nicotinamide metabolism
pcq01100  Metabolic pathways
pcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PcP3B5_30090 (sad)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PcP3B5_30090 (sad)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PcP3B5_30090 (sad)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     PcP3B5_30090 (sad)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     PcP3B5_30090 (sad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMO76430
UniProt: A0A127MTA0
Position
complement(3322448..3323833)
Genome map
AA seq 461 aa AA seqDB search
MNQIAAIPAAISRSPATGQELARYPFEDAAQLESTLARTDAAFRQWRETPVAERVAVLRR
MAEVLRANVEPMARMEAREMGMPVTQARGEINKCANLCDWYAEHGPAMLEDEKTSIEGAY
ISYLPLGPVLAVMPWNFPTWQVMRGAVSIILGGNTYVLKHAPNVMGCAYQLRDAWLQAGL
PEGVFEVLNVEPPLVSKAIVDDRIASIAVTGSVGAGAAIASQAGAALKKCVLELGGSDAF
IVLADADLDAAVKAAVASRFGNCGQVCIAAKRMIVEESIAPAFTEKLLAAVKALKIGDPL
ADDTFVGPMARFDLRDELHGQVQQAIADGASLLLGGHKLEGEGNYYAPTVLADVKPGNTA
FAKEIFGPVASVIVARDAEHALELANDSEFGLSGAIWSADKAKAQHMARRLVSGGVFING
FSASDPRVPIGGVKKSGFGRELSHFGLREFLNPQTVWIDRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatcgccgccatccccgctgccatctcgcgcagccccgccaccggccaggaa
ctggcccgctaccccttcgaggacgccgcccagctggaaagcaccctggcccgtaccgac
gccgccttccgccagtggcgcgaaaccccggtggccgagcgcgtcgccgtgctgcgcagg
atggccgaggtgctgcgcgccaacgtcgagcccatggcccgcatggaagcccgggaaatg
ggcatgccggtcactcaggcgcgcggcgagatcaacaagtgcgccaacctctgcgactgg
tacgccgagcacggcccggccatgctggaagacgagaagaccagcatcgaaggcgcgtac
atctcctacctgccgctgggcccggtgctggccgtgatgccgtggaacttccccacctgg
caggtcatgcgcggcgcggtgagcatcatcctcggcggcaacacctacgtgctcaagcac
gcaccgaacgtcatgggctgcgcctatcagttgcgcgatgcctggctgcaggccggcctg
cccgagggcgtgttcgaggtgctgaacgtggagccgccgctggtttccaaggccatcgtc
gatgaccgcatcgcctccatcgccgtgaccggcagcgtgggcgccggcgcggccatcgcc
tcccaggccggcgccgcgctgaagaagtgcgtgctggagctgggcggttccgacgccttc
atcgtgctggccgacgccgacctggacgccgctgtgaaggccgccgtggccagccgcttc
ggcaactgcggccaggtgtgcatcgccgccaagcgcatgatcgtcgaggaatccatcgcc
ccggccttcaccgagaagctgctggccgcggtcaaggcgctgaagatcggcgacccgctg
gcggacgacaccttcgtcggccccatggcccgcttcgacctgcgcgacgaactgcacggc
caggtgcaacaggccatcgccgacggcgccagcctgctgctgggcggccacaagctggaa
ggcgaaggcaactactacgcgccgaccgtgctggccgacgtgaagccgggcaacaccgcc
ttcgccaaggaaatcttcggcccggtggcttcggtgatagtcgcgcgcgacgccgagcac
gccctggaactggccaacgacagcgagttcggcctgtccggcgccatctggagcgccgac
aaggccaaggcccagcacatggcgcggcgcctggtcagcggcggcgtgttcatcaacggc
ttctccgcctccgacccgcgcgtgccgatcggcggcgtgaagaagagcggtttcggccgc
gagctgtcgcacttcggcctgcgcgagttcctcaacccgcagaccgtctggatcgaccgc
aagtaa

DBGET integrated database retrieval system