KEGG   Pseudomonas citronellolis: PcP3B5_30390Help
Entry
PcP3B5_30390      CDS       T04637                                 

Gene name
thlA_3
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00071  Fatty acid degradation
pcq00072  Synthesis and degradation of ketone bodies
pcq00280  Valine, leucine and isoleucine degradation
pcq00310  Lysine degradation
pcq00362  Benzoate degradation
pcq00380  Tryptophan metabolism
pcq00620  Pyruvate metabolism
pcq00630  Glyoxylate and dicarboxylate metabolism
pcq00640  Propanoate metabolism
pcq00650  Butanoate metabolism
pcq00900  Terpenoid backbone biosynthesis
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
pcq01212  Fatty acid metabolism
pcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PcP3B5_30390 (thlA_3)
   00630 Glyoxylate and dicarboxylate metabolism
    PcP3B5_30390 (thlA_3)
   00640 Propanoate metabolism
    PcP3B5_30390 (thlA_3)
   00650 Butanoate metabolism
    PcP3B5_30390 (thlA_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PcP3B5_30390 (thlA_3)
   00072 Synthesis and degradation of ketone bodies
    PcP3B5_30390 (thlA_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PcP3B5_30390 (thlA_3)
   00310 Lysine degradation
    PcP3B5_30390 (thlA_3)
   00380 Tryptophan metabolism
    PcP3B5_30390 (thlA_3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PcP3B5_30390 (thlA_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PcP3B5_30390 (thlA_3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PcP3B5_30390 (thlA_3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcq04147]
    PcP3B5_30390 (thlA_3)
Enzymes [BR:pcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PcP3B5_30390 (thlA_3)
Exosome [BR:pcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PcP3B5_30390 (thlA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMO76460
UniProt: A0A127MTD4
Position
3352999..3354180
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAIGAFQGSLANIPAHELGAIVIRELLQRSGVKPEQVDEVILGQVLTAG
SGQNPARQAAIAAGLPHAVPALTLNKVCGSGLKALHLAAQAIRCGDAEVVIAGGQENMSL
SPYVLPKARTGLRMGHAQLLDSMIVDGLWDAFNDYHMGITAENLVEKYGITREEQDAFAA
ASQQKAVAAIEAGRFRDEIVPVSIPQRKGEALSFDTDEQPRAGTTAEALAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSAAKAKELGLPVLARIASYASAGVDPAIMGIGPVSATRRC
LDKAGWQLAELDLVEANEAFAAQSLAVGKELGWDAAKVNVNGGAIALGHPIGASGCRVLV
SLLHEMLRRDAKKGLATLCIGGGQGVALALVRD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtagtgatagtcgccgccacccgcaccgccatcggcgccttccagggcagc
ctggcgaacatccccgcccacgaactgggcgccatcgtcatccgcgagctgctgcagcgc
agcggcgtgaagcccgagcaggtggacgaggtgatcctcggccaggtgctcaccgccggc
tccgggcagaacccggcgcgccaggccgccatcgccgccgggctgccccatgcggtgccg
gcgctgacgctgaacaaggtctgcggctcgggcctcaaggccctgcacctggccgcccag
gccatccgctgcggcgacgccgaggtggtgatcgccggcggccaggagaacatgagcctg
tcgccctacgtgctgcccaaggcccgcaccggcctgcgcatgggccatgcgcaactgctc
gacagcatgattgtcgacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggagaaatacggcatcacccgcgaggaacaggacgccttcgccgcc
gcctcgcagcagaaggccgtggccgccatcgaggccgggcgcttccgtgacgagatcgtc
ccggtgagcatcccgcagcgcaagggcgaggcgctgagcttcgacaccgatgagcagccg
cgtgccggcaccaccgccgaggccctggccaagctcaagccggcgttcaagaaggacggc
tccgttaccgccggcaacgcctccagcctcaacgacggcgccgccgccgtgctgctgatg
agcgccgccaaggccaaggaactgggcctgccggtgctggcacgcatcgcctcctacgcc
agcgccggcgtcgacccggcgatcatgggcatcggcccggtctccgccacccgccgctgc
ctggacaaggccggctggcaactggccgagctggacctggtcgaagccaacgaagccttc
gccgcgcagtccctggcggtgggcaaggaactgggctgggacgccgccaaggtcaacgtc
aacggcggcgccatcgccctcggccatcccatcggcgcttccggctgccgcgtgctggtc
agcctgctgcacgaaatgctccgccgcgatgcgaagaagggcctcgccaccctgtgcatc
ggcggtggccagggcgtggccctggccctggtccgcgactga

DBGET integrated database retrieval system