KEGG   Pseudomonas citronellolis: PcP3B5_30960Help
Entry
PcP3B5_30960      CDS       T04637                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00900  Terpenoid backbone biosynthesis
pcq01110  Biosynthesis of secondary metabolites
pcq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PcP3B5_30960 (mvaA)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     PcP3B5_30960 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AMO76515
UniProt: A0A127MTR0
Position
3414018..3415298
Genome map
AA seq 426 aa AA seqDB search
MLIDSRLPAFRNLSPRQRLDHLAALLQLPELQHLGTPGALPLEVADGMIENVLGTFELPY
AVASNFVVNGRELLVPMVVEEPSIVAAASYMAKLARAGGGFQTSSSAPLMRAQVQLVGLG
DPFNARLALLRHKAEIVELANRKDQLLNSLGGGCRDLEVHCFADSPRGPMLVAHLIVDVR
DAMGANTVNTMAEAVAPLMERISGGQARLRILSNLADLRLARAQVRIAPQQLQSPDYSGE
AVIEGILDAHCFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYG
SLSTWEKDAEGHLVGSIEMPMPVGLVGGATRTHPLAQLSLRILAVRSAQELAEIAVAVGL
AQNLGALRALACEGIQRGHMALHARNIALVAGARGEEVDWLARRLVEAGDVRADRAVELL
RERRGA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgattcccgccttcccgcattccgcaacctgtcgccacgccaacgtctcgac
cacctcgcggccctgctgcaactgcccgaactgcagcacctgggcacacccggcgcactg
ccgctggaggtggccgacggcatgatcgagaacgtgctcggcaccttcgagctgccctac
gcggtggccagcaatttcgtggtcaacggccgcgagctgctggtgccgatggtggtggag
gagccgtcgatcgtcgccgccgcctcctacatggccaagctggcccgcgccggcggcggc
ttccagacctccagcagcgcgccgctgatgcgcgcccaagtccagctggtgggcctgggc
gacccgttcaacgcgcgcctggcgctgctgcggcacaaggccgagatcgtcgagctggcc
aaccgcaaggaccagttgctcaacagcctgggtggcggctgccgcgacctggaagtgcac
tgcttcgccgacagcccgcgcgggccgatgctggtggcgcacctgatcgtcgacgtgcgc
gacgccatgggcgccaacacggtgaataccatggccgaggccgtggccccgctgatggag
cgcatcagcggcggccaggcgcgcctgcgcatcctctccaacctcgccgacctgcgcctg
gctcgggcccaggtccgtatcgccccacagcagttgcagtcgccggactacagcggcgag
gcggtgatcgagggcatcctcgacgcccactgtttcgccgccgtcgacccctaccgcgcg
gccacacacaacaagggcatcatgaacggtatcgaccccctgatcgtcgccaccggcaac
gactggcgcgccgtggaggcgggcgcccacgcctacgcctgccgcagcggccactacggc
tcgctgagcacctgggagaaggacgccgagggacacctggtgggcagcatcgagatgccc
atgccggtgggcctggtcggcggcgccacccgcacccatccgctggcccagctgtcgctg
cgcatcctcgccgtgcgcagcgcccaggaactggccgaaatcgccgtggccgtgggcctg
gcgcagaacctcggggccttgcgcgccctggcctgcgaaggcatccagcgcggccacatg
gcgctgcacgcacgcaacatcgccctggtggccggcgcccgcggcgaggaagtggactgg
ctggcgcggcgcctggtggaagccggcgacgtgcgcgccgaccgcgccgtggaactgctg
cgcgaaaggcgcggcgcatga

DBGET integrated database retrieval system