KEGG   Pseudomonas citronellolis: PcP3B5_51300Help
Entry
PcP3B5_51300      CDS       T04637                                 

Gene name
gpx2
Definition
(GenBank) Hydroperoxy fatty acid reductase gpx2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00480  Glutathione metabolism
pcq00590  Arachidonic acid metabolism
pcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PcP3B5_51300 (gpx2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PcP3B5_51300 (gpx2)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PcP3B5_51300 (gpx2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMO78514
UniProt: A0A127MYV6
Position
complement(5685895..5686377)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLRGLDGQDLPLSPLKGKVVLVVNVASRCGLTPQYAGLEKLYQQYRDRGFVVL
GLPCNQFAGQEPGSEADIQSFCSLNYGVSFPMSAKLEVNGPERHPLYRLLAGEGAEFPGD
ITWNFEKFLLAPDGRVLARFSPRTAPDDAALVQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttttcacgatctgactctgcgtggcctggatggccaggatctgccgctctcc
ccattgaagggcaaggtggtgctggtggtgaacgtcgcctccaggtgtggtctgaccccg
cagtacgccgggctggagaagctctaccagcaataccgcgaccgcggcttcgtggtcctg
ggcctgccctgcaaccagttcgccggccaggagccgggcagcgaggcggacatccagtcg
ttctgctcgctgaactacggcgtcagcttcccgatgtcggccaagctcgaggtcaacggc
cccgagcgccatccgctgtaccgcctgctggcgggcgagggcgccgagttccccggcgac
atcacctggaacttcgagaagttcctgctcgcccccgacggccgcgtgctggcgcgcttc
agcccgcgcaccgcgccggacgacgcggccctggtgcaggccatcgagaaggccctgggc
tga

DBGET integrated database retrieval system