KEGG   Pseudomonas citronellolis: PcP3B5_52530Help
Entry
PcP3B5_52530      CDS       T04637                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pcq  Pseudomonas citronellolis
Pathway
pcq00020  Citrate cycle (TCA cycle)
pcq00620  Pyruvate metabolism
pcq01100  Metabolic pathways
pcq01110  Biosynthesis of secondary metabolites
pcq01120  Microbial metabolism in diverse environments
pcq01130  Biosynthesis of antibiotics
pcq01200  Carbon metabolism
Module
pcq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PcP3B5_52530 (mqo)
   00620 Pyruvate metabolism
    PcP3B5_52530 (mqo)
Enzymes [BR:pcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PcP3B5_52530 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMO78636
UniProt: A0A127MZE8
Position
5841485..5842969
Genome map
AA seq 494 aa AA seqDB search
MANEHEALDVLLVGAGIMSATLATLLKEVEPGTRLEIVELQESGAIESSNPWNNAGTGHA
GLCELNYTPQAADGSIDIKKAVQINAQFEVSKQFWAHLVDKEGFGNPRNFINPVPHLSFV
RGKDVPFLKKRFETLSQHHAFESMVYTEDREQLGQWAPLTIPGRPADEQVAATRVEHGTD
VNFGALTNQLLARLGKQDGAKVSYFQKVVGLERDGQDWIVDIKNTQNGQSRKIRAKFVFL
GAGGGALPLLQMSGIPESKGFGGFPVSGQWLRCDNPEVVRQHQAKVYSQAEVGAPPMSVP
HLDTRVVDGRKSLLFGPYAGFSTKFLRHGSFLDLPLSVRGSNLMPMLAVARDNMDLTRYL
VREVMQSMDQRLESLRKFYPLANPADWRLETAGQRVQIIKKDAKKGGILQFGTELVASED
GTIAALLGASPGASVTVSIMLGLLERCFPQQYKSEAWGAKLKEIFPAREKQLETDASAYR
EINAYTWQKLQLDQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaacacgaagcgttggatgtgctgctggttggcgccggcatcatgagcgca
accctggcgaccctgttgaaggaagtcgaacccggcacccgcctggagatcgtcgaactg
caggagtccggagccatcgagagctccaacccctggaacaacgccggcaccggccacgcc
ggcctctgcgagctgaactacacgccgcaggccgccgatggctccatcgacatcaagaaa
gcggtgcagatcaacgcccagttcgaggtgtccaagcagttctgggcgcacctggtggac
aaggaaggcttcggcaatccgcgcaacttcatcaacccggtgccgcacctgagcttcgtc
cgtggcaaggacgtgcccttcctgaagaagcgcttcgagacgctgagccagcaccacgcc
ttcgagtccatggtctacaccgaggaccgcgagcagctgggccagtgggcgccgctgacc
atccccggccgcccggccgacgagcaggtcgccgccacccgcgtcgagcacggcaccgac
gtcaacttcggcgccctgaccaaccaactgctggcccgtctgggcaagcaggacggcgcg
aaagtcagctacttccagaaggtcgtgggccttgagcgcgacggccaggactggatcgtc
gacatcaagaacacccagaacggccagtcgcgcaagatccgcgcgaagttcgtcttcctc
ggcgccggcggcggcgcgctgccgctgctgcagatgtccggcatcccggaaagcaagggc
ttcggcggcttcccggtgagcggccagtggctgcgctgcgacaaccccgaggtggtcagg
cagcaccaggccaaggtctacagccaggccgaggtcggcgccccgccgatgtccgtgccg
cacctggacacccgcgtggtcgacggtaggaagtccctgctgttcgggccctacgccggc
ttctccaccaagttcctgcgccacggctccttcctcgacctgccgctgtcggtgcgcggc
agcaacctgatgccgatgctggcagtcgcccgcgacaacatggacctgacccgctacctg
gtgcgcgaagtcatgcagtccatggaccagcgcctggaaagcctgcgcaagttctacccg
ctggccaacccggccgactggcgcctggaaaccgccggccagcgcgtgcagatcatcaag
aaggacgccaagaaaggcggcatcctgcagttcggcaccgagctggtggcctccgaggac
ggcaccatcgccgccctgctgggcgcctccccgggcgcgtcggtcaccgtatcgatcatg
ctcggcctgctggagcgctgcttcccgcagcagtacaagtccgaagcctggggcgccaag
ctcaaggaaatcttcccggcccgcgagaagcagctggagaccgatgcctcggcctaccgc
gagatcaacgcctacacctggcagaagctgcagctggatcagtga

DBGET integrated database retrieval system