KEGG   Psychrobacter cryohalolentis: Pcryo_0278Help
Entry
Pcryo_0278        CDS       T00350                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00071  Fatty acid degradation
pcr00072  Synthesis and degradation of ketone bodies
pcr00280  Valine, leucine and isoleucine degradation
pcr00310  Lysine degradation
pcr00362  Benzoate degradation
pcr00380  Tryptophan metabolism
pcr00620  Pyruvate metabolism
pcr00630  Glyoxylate and dicarboxylate metabolism
pcr00640  Propanoate metabolism
pcr00650  Butanoate metabolism
pcr00900  Terpenoid backbone biosynthesis
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
pcr01212  Fatty acid metabolism
pcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pcryo_0278
   00630 Glyoxylate and dicarboxylate metabolism
    Pcryo_0278
   00640 Propanoate metabolism
    Pcryo_0278
   00650 Butanoate metabolism
    Pcryo_0278
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pcryo_0278
   00072 Synthesis and degradation of ketone bodies
    Pcryo_0278
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pcryo_0278
   00310 Lysine degradation
    Pcryo_0278
   00380 Tryptophan metabolism
    Pcryo_0278
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pcryo_0278
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pcryo_0278
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pcryo_0278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcr04147]
    Pcryo_0278
Enzymes [BR:pcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pcryo_0278
Exosome [BR:pcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pcryo_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABE74062
UniProt: Q1QE41
Position
complement(331717..332898)
Genome map
AA seq 393 aa AA seqDB search
MSHDAIVILNGARTPMGGFQGALTDISATDLGAAAIKAAVARSGVNVDNIDEVIMGCILT
AGLGQGPARQAMRKAGLSDATGAVTINKLCGSGLKAVMQAHDGIKAGSFKVAVAGGMESM
TNAPYIMPGSRGGYRMGHKEVKDHMFLDGLEDADTGKLMGQFAQEMADEKGYTREQMDDF
AIESLNRALTAIKDNHFKDEIEPVTFKTRKGEQTVDTDEQPALANAERIPTLRPAFAKDG
TITAANASSISDGAAAVVLMKESQAKEEGLEYQARIIATASNSRHPSEFTIAPVGAIEKV
LASASWSVADVDLWEINEAFAMVTMAAMDELNIEHAKVNIEGGACALGHPVGCSGARILV
TLINSLKRTGGKKGVATLCIGGGEAVAVAIELA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgatgcaattgtaatcttaaacggcgctcgcaccccgatgggcggcttccaa
ggcgcattgacagacataagcgccacagatttgggcgcagcggctatcaaagcagctgtt
gcgcgttcaggcgttaatgttgataatattgatgaagttattatgggctgtatcttaacc
gcaggtttgggtcaaggtcctgcgcgtcaagcgatgcgcaaagctggcttgtctgatgca
acgggtgcggttaccatcaataagctgtgcggctcaggtctaaaagcagttatgcaagct
catgacggtatcaaagccggaagctttaaggttgctgttgctggcggtatggagtcgatg
accaatgcgccttatatcatgccagggtcgcgtggtggctatcgcatgggacataaagaa
gtcaaagatcatatgttcttagacggtctagaagatgccgatactggcaagctaatgggt
caatttgcacaagaaatggcggatgaaaaaggctatacgcgcgaacaaatggatgatttt
gctattgagtcgctaaatcgtgcactaacagcgatcaaagacaatcatttcaaagatgaa
attgaaccagttacgttcaaaactcgtaaaggcgagcaaacggttgataccgatgagcag
cctgcccttgctaatgctgagcgcatccctactttgcgtcctgcctttgcaaaagacggt
accatcaccgcagcaaacgctagctctatctcagacggtgctgcagctgttgtattgatg
aaagagtcacaagccaaagaagaaggtctagagtatcaagcgcgtatcatcgcgactgcc
tctaattctcgtcatccaagcgagttcactattgcccctgttggcgcaattgaaaaagta
ttggcaagtgctagctggtcagtcgctgatgtcgatttatgggaaatcaatgaagcattt
gccatggttacgatggcagcaatggatgagctaaacatcgaacatgctaaagtaaacata
gaaggcggtgcttgtgcccttggtcatccagtgggctgttcaggcgctcgtatcctagtg
acgcttattaactctctaaagcgtactggtggcaaaaaaggcgttgctacactatgtatc
ggtggcggcgaagcagtagcagtagcaatcgaattggcttaa

DBGET integrated database retrieval system